BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0661 (363 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0339 - 22400534-22400647,22401264-22401398,22401491-224015... 73 9e-14 08_02_1576 + 27965862-27965864,27965952-27966026,27966113-279662... 73 9e-14 11_01_0334 + 2495275-2495433,2495553-2495661,2496311-2496378,249... 56 6e-09 03_05_0586 - 25875703-25876332,25876426-25876713,25877064-258771... 30 0.64 05_04_0342 - 20425141-20425311,20425415-20425558,20426506-204266... 28 2.0 04_03_0024 - 9623178-9624001,9624502-9624678,9625144-9625305,962... 27 3.4 11_06_0621 + 25587476-25587604,25588230-25588423,25588800-255888... 27 4.5 02_05_0114 + 25958834-25961296 27 4.5 11_06_0177 + 20936072-20937550 27 6.0 10_08_1023 - 22341815-22342042,22342179-22342247,22342717-223428... 27 6.0 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 27 6.0 06_03_1117 + 27750291-27750338,27751360-27751812,27751987-277521... 27 6.0 05_03_0497 - 14715267-14715548,14715648-14715830,14715911-147166... 27 6.0 02_03_0349 + 18010414-18014283 27 6.0 08_02_1171 + 24880363-24881355,24882553-24882702,24883505-248842... 26 7.9 05_01_0049 - 337132-337488,337613-337765,337924-338551,338617-33... 26 7.9 01_06_0968 + 33466574-33466607,33467087-33467115,33467438-334675... 26 7.9 >09_06_0339 - 22400534-22400647,22401264-22401398,22401491-22401565, 22401646-22401648 Length = 108 Score = 72.5 bits (170), Expect = 9e-14 Identities = 32/51 (62%), Positives = 43/51 (84%) Frame = +2 Query: 107 RDKLNNQVLXDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIDL 259 ++K+NN VL D+ TY+KL EVP+YK ITP+V+SERL++ GSLARRA+ DL Sbjct: 34 KEKVNNSVLFDQATYDKLLSEVPKYKQITPSVLSERLRINGSLARRAMKDL 84 Score = 28.7 bits (61), Expect = 1.5 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +1 Query: 256 LREKGLIKQVVQHHGQVIYTRAT 324 L ++GLI+ V H Q IYTRAT Sbjct: 84 LMDRGLIRMVSVHCSQQIYTRAT 106 >08_02_1576 + 27965862-27965864,27965952-27966026,27966113-27966247, 27967080-27967193 Length = 108 Score = 72.5 bits (170), Expect = 9e-14 Identities = 32/51 (62%), Positives = 43/51 (84%) Frame = +2 Query: 107 RDKLNNQVLXDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIDL 259 ++K+NN VL D+ TY+KL EVP+YK ITP+V+SERL++ GSLARRA+ DL Sbjct: 34 KEKVNNSVLFDQATYDKLLSEVPKYKQITPSVLSERLRINGSLARRAINDL 84 Score = 28.7 bits (61), Expect = 1.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 241 KSTHRLREKGLIKQVVQHHGQVIYTRAT 324 ++ + L +GLI+ V H Q IYTRAT Sbjct: 79 RAINDLMTRGLIRMVSVHSSQQIYTRAT 106 >11_01_0334 + 2495275-2495433,2495553-2495661,2496311-2496378, 2496476-2496577,2496853-2497003,2497173-2497222, 2497432-2497557,2497761-2497863,2498104-2498204, 2498540-2498677,2498768-2498911,2499028-2499103, 2499224-2499309,2499432-2499560,2500572-2500674, 2500776-2500843,2500912-2501013,2501432-2501527, 2501723-2501848,2502152-2502254,2502427-2502569, 2503017-2503154,2503248-2503391,2503535-2503610, 2503883-2503968,2504135-2504212,2505180-2505254, 2505362-2505496,2506240-2506272,2507886-2507905, 2508570-2508666,2508899-2509000,2510612-2510725 Length = 1126 Score = 56.4 bits (130), Expect = 6e-09 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = +2 Query: 107 RDKLNNQVLXDKPTYEKLYKEVPQYKLITPAVVSERLK 220 ++K+NN VL DK TY+KL EVP+YK ITP+V+SERL+ Sbjct: 968 KEKVNNSVLFDKATYDKLLSEVPKYKQITPSVLSERLR 1005 Score = 27.5 bits (58), Expect = 3.4 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 256 LREKGLIKQVVQHHGQVIYTRAT 324 L +G I+ V H Q+IYTRAT Sbjct: 1102 LESRGAIRVVSVHSSQLIYTRAT 1124 >03_05_0586 - 25875703-25876332,25876426-25876713,25877064-25877194, 25877299-25877812 Length = 520 Score = 29.9 bits (64), Expect = 0.64 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +1 Query: 7 REGFGQTASKNTEEEGRIRWRQSXEEEVVQRKSS*QVEQPGV 132 R G G + + E G+ +WR+ EEE Q+K + E+ V Sbjct: 345 RGGRGGESEERRRERGKGKWREEEEEEEEQQKGQEEEEEEQV 386 >05_04_0342 - 20425141-20425311,20425415-20425558,20426506-20426622, 20426719-20426835,20427533-20427678,20428208-20428293, 20428780-20428889 Length = 296 Score = 28.3 bits (60), Expect = 2.0 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = +2 Query: 104 VRDKLNNQVLXDKPTYEKLYKEVPQYKLITPAVVSERLKVRGSLARRALIDLGKKVS 274 V+D + L DKP YE L P + L+ S+ + VR + A L DL K VS Sbjct: 187 VKDSVKEDKLRDKPGYEHL--NDPLHVLVEAEFPSDIVDVRLNQAVAILEDLLKPVS 241 >04_03_0024 - 9623178-9624001,9624502-9624678,9625144-9625305, 9625520-9626032,9626801-9629153 Length = 1342 Score = 27.5 bits (58), Expect = 3.4 Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +2 Query: 119 NNQVLXDKPTYEKLYKEVPQYKLITPAVVSERL--KVRGSLARRALIDLGKKVSSNR 283 NN+V+ KP Y ++P + +V++++ K+ G L+ + ID+ + ++ R Sbjct: 1156 NNEVIQQKPIYVVFDGKLPGVYISFEEIVAQKIDAKLMGGLSWKKYIDIDEALTQAR 1212 >11_06_0621 + 25587476-25587604,25588230-25588423,25588800-25588874, 25589434-25591852 Length = 938 Score = 27.1 bits (57), Expect = 4.5 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -2 Query: 179 TVGLPCTVSHMWVYXTTPGCSTCHELFLWTTSSSWLCRHRILPS 48 T PC++S M V C TC+++ S +CR ++PS Sbjct: 264 TCATPCSLSFM-VDCLIKACITCYDVQATICLFSGICRLGVVPS 306 >02_05_0114 + 25958834-25961296 Length = 820 Score = 27.1 bits (57), Expect = 4.5 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -2 Query: 179 TVGLPCTVSHMWVYXTTPGCSTCHELFLWTTSSSWLCRHRILPS 48 T PC++S M V C TC+++ S +CR ++PS Sbjct: 146 TCATPCSLSFM-VDCLIKACITCYDVQATICLFSGICRLGVVPS 188 >11_06_0177 + 20936072-20937550 Length = 492 Score = 26.6 bits (56), Expect = 6.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 102 FPLDHFFFXALPPPDP 55 FPLD+ FF PPP P Sbjct: 218 FPLDYAFFDGGPPPRP 233 >10_08_1023 - 22341815-22342042,22342179-22342247,22342717-22342840, 22343193-22343317,22343815-22344276,22344357-22344700, 22345061-22345406,22345492-22345941,22346760-22347051, 22347171-22347515,22347611-22347834,22348072-22348563, 22348664-22349056,22349601-22349741,22349845-22350207, 22350494-22352683,22353298-22353360,22353434-22353535, 22353672-22354027,22354326-22354413,22354517-22354750, 22355508-22355975 Length = 2632 Score = 26.6 bits (56), Expect = 6.0 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +1 Query: 247 THRLREKGLIKQVVQHHG 300 TH++R + LI+QV+QH G Sbjct: 1455 THKMRAEHLIRQVLQHLG 1472 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 26.6 bits (56), Expect = 6.0 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = -1 Query: 261 PKSMSALLAREPRTFNLSDTTAGVISLYCGTSLYSFSYVGLSXNTWLFNLS 109 PKS S LL E R T A I ++C + S+ L N LF +S Sbjct: 585 PKSASELLQAEDRAHRRGQTNAVNIYIFCARNTLDESH-WLHLNQSLFRVS 634 >06_03_1117 + 27750291-27750338,27751360-27751812,27751987-27752161, 27752227-27752551,27752705-27752786,27752820-27752889, 27753341-27753420,27753514-27753750 Length = 489 Score = 26.6 bits (56), Expect = 6.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 13 GFGQTASKNTEEEGRIRWRQSXEEEVVQRKSS*QVEQPG 129 GFG S N+ +RWR +++ Q Q ++PG Sbjct: 427 GFGIAISANSMLVEYLRWRSRRNQQLAQTVDDGQRQEPG 465 >05_03_0497 - 14715267-14715548,14715648-14715830,14715911-14716668, 14716762-14717167,14717274-14717399,14717506-14717625, 14717675-14718463,14718554-14718709,14718800-14718898, 14718989-14719108,14719165-14719251 Length = 1041 Score = 26.6 bits (56), Expect = 6.0 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = -1 Query: 219 FNLSDTTAGVISLYCGTSLYSFSYVGLSXNT--WLFNLSRTFPLDHFFF 79 F ++ A +I++Y +G S WLF++ FPLD F F Sbjct: 882 FLIAQLMATLIAVYANWPFAKMKGIGWSWGMVIWLFSIVTFFPLDIFKF 930 >02_03_0349 + 18010414-18014283 Length = 1289 Score = 26.6 bits (56), Expect = 6.0 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 140 KPTYEKLYKEVPQYKLITPAVVSERL 217 KPT E+L K +PQ K++ AV E + Sbjct: 39 KPTRERLEKLLPQIKVVLDAVDMEHI 64 >08_02_1171 + 24880363-24881355,24882553-24882702,24883505-24884210, 24885012-24885404,24885759-24885805,24886088-24886111 Length = 770 Score = 26.2 bits (55), Expect = 7.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 363 NLYHSLCDWIIALGRTRVDHLP 298 NL+H++ DW A +RV LP Sbjct: 347 NLFHTITDWYSAYVSSRVTDLP 368 >05_01_0049 - 337132-337488,337613-337765,337924-338551,338617-338852, 339563-339577 Length = 462 Score = 26.2 bits (55), Expect = 7.9 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -2 Query: 119 STCHELFLWTTSSSWLCRHRILPSSSVFF--EAVWPKPSRP 3 STCH++ L S WL L S + F E VW P P Sbjct: 261 STCHKMQLPFKLSDWLSTVPTLTSLHLDFQDEMVWILPEEP 301 >01_06_0968 + 33466574-33466607,33467087-33467115,33467438-33467595, 33468319-33468436,33468520-33468708,33469008-33469343, 33469468-33469569,33469696-33469890,33469993-33470155, 33470314-33470579,33470670-33470765,33470860-33471255, 33471403-33471501 Length = 726 Score = 26.2 bits (55), Expect = 7.9 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = -1 Query: 294 VLDYLFD----ETFFPKSMSALLAREPRTFNLSDTTAGVISL 181 V+D+L D TFFP+ +S + T+ SD GVI L Sbjct: 281 VVDFLMDPYNYRTFFPEVISGAVTNRIYTWPTSDGYNGVIQL 322 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,433,929 Number of Sequences: 37544 Number of extensions: 210897 Number of successful extensions: 594 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 566473892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -