BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0660 (1005 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 40 0.003 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.006 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_23020| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_1570| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 38 0.010 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.013 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 38 0.013 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 38 0.017 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.017 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) 37 0.022 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 37 0.030 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 37 0.030 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.030 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 36 0.039 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 36 0.039 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 36 0.039 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 36 0.039 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 36 0.039 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.039 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 36 0.039 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 36 0.039 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 36 0.039 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 36 0.039 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 36 0.039 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 36 0.039 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 36 0.039 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 36 0.039 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 36 0.039 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 36 0.039 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 36 0.039 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 36 0.039 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 36 0.039 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 36 0.039 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 36 0.039 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 36 0.039 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 36 0.039 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 36 0.039 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 36 0.039 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 36 0.039 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 36 0.039 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 36 0.039 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 36 0.039 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 36 0.039 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 36 0.039 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 36 0.039 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 36 0.039 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 36 0.039 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 36 0.039 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 36 0.039 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 36 0.039 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 36 0.039 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 36 0.039 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_51470| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_51374| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50670| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 36 0.039 SB_49267| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48925| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48334| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47996| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47774| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47576| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47430| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46791| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46688| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46485| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 36 0.039 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_45961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_44850| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 36 0.039 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 36 0.039 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 36 0.039 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 36 0.039 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_42545| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_42492| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 36 0.039 SB_42077| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 36 0.039 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40947| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40885| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 36 0.039 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39773| Best HMM Match : DUF765 (HMM E-Value=4.1) 36 0.039 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39409| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 36 0.039 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.039 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_38978| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 36 0.039 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_37896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_37019| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 36 0.039 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_36228| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 36 0.039 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_34686| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 36 0.039 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_33797| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_33093| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_32799| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 36 0.039 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 40.3 bits (90), Expect = 0.002 Identities = 28/74 (37%), Positives = 40/74 (54%), Gaps = 5/74 (6%) Frame = +3 Query: 6 SSTAVXAALELVXPPGCRFLNALIY*R----KKKHRCIQDEVRNKGYFIL-KISNSHKAV 170 SSTAV AALELV PPGCR N++IY +K H Q + Y +L K+ ++ + Sbjct: 81 SSTAVAAALELVDPPGCR--NSMIYENYILLRKLHSTAQTTLYFANYILLRKLHSTTQTT 138 Query: 171 L*I*QLVVF*EFHS 212 L ++ + HS Sbjct: 139 LYYANYIILRKLHS 152 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = -1 Query: 105 YIYVFFFVNK*EHLKTCSPGXXLVLERPPXRWS 7 Y++V NK + +CSPG LVLERPP RWS Sbjct: 35 YLFVLLVANKPSN--SCSPGDPLVLERPPPRWS 65 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/35 (54%), Positives = 23/35 (65%), Gaps = 2/35 (5%) Frame = -1 Query: 105 YIYVFFFVNK*EHL--KTCSPGXXLVLERPPXRWS 7 YI+++ FV L +CSPG LVLERPP RWS Sbjct: 4 YIFLYGFVELISFLISNSCSPGDPLVLERPPPRWS 38 >SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) Length = 263 Score = 39.9 bits (89), Expect = 0.003 Identities = 19/35 (54%), Positives = 21/35 (60%) Frame = -1 Query: 111 PGYIYVFFFVNK*EHLKTCSPGXXLVLERPPXRWS 7 P Y+F F E +CSPG LVLERPP RWS Sbjct: 2 PRQFYIFLFCCG-ELSNSCSPGDPLVLERPPPRWS 35 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -1 Query: 84 VNK*EHLKTCSPGXXLVLERPPXRWS 7 VN+ E +CSPG LVLERPP RWS Sbjct: 10 VNRDEVSNSCSPGDPLVLERPPPRWS 35 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -1 Query: 84 VNK*EHLKTCSPGXXLVLERPPXRWS 7 +NK E +CSPG LVLERPP RWS Sbjct: 1 MNKAEVSNSCSPGDPLVLERPPPRWS 26 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/35 (51%), Positives = 24/35 (68%), Gaps = 2/35 (5%) Frame = -1 Query: 105 YIYVFFFVNK*EHLKT--CSPGXXLVLERPPXRWS 7 Y+ + F N ++L++ CSPG LVLERPP RWS Sbjct: 7 YLRIEFLSNPPKNLRSNSCSPGDPLVLERPPPRWS 41 >SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/37 (48%), Positives = 23/37 (62%) Frame = -1 Query: 117 LRPGYIYVFFFVNK*EHLKTCSPGXXLVLERPPXRWS 7 L G+++V F + +CSPG LVLERPP RWS Sbjct: 6 LNTGFVWVLSFFSP---SNSCSPGDPLVLERPPPRWS 39 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 39.1 bits (87), Expect = 0.006 Identities = 18/37 (48%), Positives = 20/37 (54%) Frame = -1 Query: 117 LRPGYIYVFFFVNK*EHLKTCSPGXXLVLERPPXRWS 7 L P F N+ +CSPG LVLERPP RWS Sbjct: 39 LVPSTSVTLFIENRLMRSNSCSPGDPLVLERPPPRWS 75 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/28 (57%), Positives = 17/28 (60%) Frame = -1 Query: 90 FFVNK*EHLKTCSPGXXLVLERPPXRWS 7 FF +CSPG LVLERPP RWS Sbjct: 46 FFAENGSESNSCSPGDPLVLERPPPRWS 73 >SB_23020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 38.7 bits (86), Expect = 0.007 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 69 HLKTCSPGXXLVLERPPXRWS 7 H +CSPG LVLERPP RWS Sbjct: 5 HAHSCSPGDPLVLERPPPRWS 25 >SB_1570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/24 (79%), Positives = 20/24 (83%) Frame = -3 Query: 76 MRAFKNLQPGGXTSSRAAXTAVEL 5 MRA + LQPGG TSSRAA TAVEL Sbjct: 1 MRAIEFLQPGGSTSSRAAATAVEL 24 >SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) Length = 270 Score = 38.3 bits (85), Expect = 0.010 Identities = 21/59 (35%), Positives = 30/59 (50%) Frame = -1 Query: 183 VKFRALPCVNC*FLI*NNPCFLLRPGYIYVFFFVNK*EHLKTCSPGXXLVLERPPXRWS 7 V ++ PCV + + CF+L ++ + +CSPG LVLERPP RWS Sbjct: 113 VTYKQQPCVPF-YDMEAQVCFILHCNLLFSINLITS----NSCSPGDPLVLERPPPRWS 166 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 78 K*EHLKTCSPGXXLVLERPPXRWS 7 K E +CSPG LVLERPP RWS Sbjct: 9 KLERSNSCSPGDPLVLERPPPRWS 32 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 37.9 bits (84), Expect = 0.013 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -1 Query: 90 FFVNK*EHLKTCSPGXXLVLERPPXRWS 7 +++ K +CSPG LVLERPP RWS Sbjct: 35 YYLQKKNASNSCSPGDPLVLERPPPRWS 62 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 37.9 bits (84), Expect = 0.013 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 3/35 (8%) Frame = -1 Query: 102 IYVFFFVNK*EHLK---TCSPGXXLVLERPPXRWS 7 I F+ N H + +CSPG LVLERPP RWS Sbjct: 18 IQCVFYSNSTPHFRVSNSCSPGDPLVLERPPPRWS 52 >SB_36586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.9 bits (84), Expect = 0.013 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = -1 Query: 96 VFFFVNK*EHLKTCSPGXXLVLERPPXRWS 7 +F+F + +CSPG LVLERPP RWS Sbjct: 2 IFWFGSGIRTSNSCSPGDPLVLERPPPRWS 31 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 37.9 bits (84), Expect = 0.013 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = -1 Query: 99 YVFFFVNK*EHLK-TCSPGXXLVLERPPXRWS 7 Y+F +N + +CSPG LVLERPP RWS Sbjct: 651 YIFAILNSLQLASNSCSPGDPLVLERPPPRWS 682 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 37.5 bits (83), Expect = 0.017 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = -1 Query: 102 IYVFFFVNK*EHLKTCSPGXXLVLERPPXRWS 7 I VFF + +CSPG LVLERPP RWS Sbjct: 193 ICVFFLMYS-SSSNSCSPGDPLVLERPPPRWS 223 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.5 bits (83), Expect = 0.017 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 7 ERSNSCSPGDPLVLERPPPRWS 28 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 37.5 bits (83), Expect = 0.017 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -1 Query: 87 FVNK*EHLKTCSPGXXLVLERPPXRWS 7 ++N +CSPG LVLERPP RWS Sbjct: 18 YINIIRQSNSCSPGDPLVLERPPPRWS 44 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.5 bits (83), Expect = 0.017 Identities = 16/23 (69%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -1 Query: 72 EHLK-TCSPGXXLVLERPPXRWS 7 EH+ +CSPG LVLERPP RWS Sbjct: 2 EHVSNSCSPGDPLVLERPPPRWS 24 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.5 bits (83), Expect = 0.017 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 6 ERSNSCSPGDPLVLERPPPRWS 27 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 37.5 bits (83), Expect = 0.017 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 30 ERSNSCSPGDPLVLERPPPRWS 51 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 37.5 bits (83), Expect = 0.017 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 20 ERSNSCSPGDPLVLERPPPRWS 41 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.1 bits (82), Expect = 0.022 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 10 EKSNSCSPGDPLVLERPPPRWS 31 >SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 37.1 bits (82), Expect = 0.022 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -3 Query: 76 MRAFKNLQPGGXTSSRAAXTAVEL 5 MR + LQPGG TSSRAA TAVEL Sbjct: 88 MRGIEFLQPGGSTSSRAAATAVEL 111 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 37.1 bits (82), Expect = 0.022 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -1 Query: 84 VNK*EHLKTCSPGXXLVLERPPXRWS 7 ++K + +CSPG LVLERPP RWS Sbjct: 21 LSKSKRSNSCSPGDPLVLERPPPRWS 46 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = -1 Query: 111 PGYIYVFFFVNK*EHLKTCSPGXXLVLERPPXRWS 7 P I V ++ + +CSPG LVLERPP RWS Sbjct: 96 PDEIPVVGLKHRDQRSNSCSPGDPLVLERPPPRWS 130 >SB_49082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/40 (50%), Positives = 22/40 (55%) Frame = -1 Query: 126 CFLLRPGYIYVFFFVNK*EHLKTCSPGXXLVLERPPXRWS 7 C L R Y FF + +CSPG LVLERPP RWS Sbjct: 3 CQLSRNPTTYRMFFQSN-----SCSPGDPLVLERPPPRWS 37 >SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 78 K*EHLKTCSPGXXLVLERPPXRWS 7 K E +CSPG LVLERPP RWS Sbjct: 4 KLEPSNSCSPGDPLVLERPPPRWS 27 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/27 (62%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Frame = -1 Query: 84 VNK*EHLK-TCSPGXXLVLERPPXRWS 7 +NK + L +CSPG LVLERPP RWS Sbjct: 41 LNKVQSLSNSCSPGDPLVLERPPPRWS 67 >SB_35297| Best HMM Match : CO_deh_flav_C (HMM E-Value=4.8) Length = 351 Score = 37.1 bits (82), Expect = 0.022 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 226 ESSNSCSPGDPLVLERPPPRWS 247 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/24 (70%), Positives = 18/24 (75%), Gaps = 3/24 (12%) Frame = -1 Query: 69 HLK---TCSPGXXLVLERPPXRWS 7 HLK +CSPG LVLERPP RWS Sbjct: 15 HLKVSNSCSPGDPLVLERPPPRWS 38 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/24 (66%), Positives = 19/24 (79%), Gaps = 2/24 (8%) Frame = -1 Query: 72 EHLKT--CSPGXXLVLERPPXRWS 7 +HL++ CSPG LVLERPP RWS Sbjct: 211 KHLRSNSCSPGDPLVLERPPPRWS 234 >SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 37.1 bits (82), Expect = 0.022 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 10 ESSNSCSPGDPLVLERPPPRWS 31 >SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 37.1 bits (82), Expect = 0.022 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = -1 Query: 102 IYVFFFVNK*EHLKTCSPGXXLVLERPPXRWS 7 +Y+F+ N +CSPG LVLERPP RWS Sbjct: 3 LYIFYASN------SCSPGDPLVLERPPPRWS 28 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 37.1 bits (82), Expect = 0.022 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -1 Query: 90 FFVNK*EHLKTCSPGXXLVLERPPXRWS 7 +F+N + +CSPG LVLERPP RWS Sbjct: 5 YFINSVSN--SCSPGDPLVLERPPPRWS 30 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 36.7 bits (81), Expect = 0.030 Identities = 16/22 (72%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -1 Query: 69 HLK-TCSPGXXLVLERPPXRWS 7 HL +CSPG LVLERPP RWS Sbjct: 161 HLSNSCSPGDPLVLERPPPRWS 182 >SB_14086| Best HMM Match : POR (HMM E-Value=7.7) Length = 292 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 167 EPSNSCSPGDPLVLERPPPRWS 188 >SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 36.7 bits (81), Expect = 0.030 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 2/41 (4%) Frame = -1 Query: 123 FLLRPGYIYVFFFVNK*EHLKT--CSPGXXLVLERPPXRWS 7 F+L + + F + +H ++ CSPG LVLERPP RWS Sbjct: 9 FVLNTSFWCLVFILLVHDHNQSNSCSPGDPLVLERPPPRWS 49 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.7 bits (81), Expect = 0.030 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +3 Query: 6 SSTAVXAALELVXPPGCRFLNALIY*RKKKHRCIQDEVRNKG 131 SSTAV AALELV PPGCR N++ K H+ ++D+ ++G Sbjct: 5 SSTAVAAALELVDPPGCR--NSI-----KVHKDVKDKPSHQG 39 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 36.7 bits (81), Expect = 0.030 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = +3 Query: 6 SSTAVXAALELVXPPGCRFLNALIY 80 SSTAV AALELV PPGCR N++ Y Sbjct: 5 SSTAVAAALELVDPPGCR--NSMFY 27 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.7 bits (81), Expect = 0.030 Identities = 16/22 (72%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -1 Query: 69 HLK-TCSPGXXLVLERPPXRWS 7 HL +CSPG LVLERPP RWS Sbjct: 22 HLSNSCSPGDPLVLERPPPRWS 43 >SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 13 EPSNSCSPGDPLVLERPPPRWS 34 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.7 bits (81), Expect = 0.030 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -1 Query: 87 FVNK*EHLKTCSPGXXLVLERPPXRWS 7 FV+ +CSPG LVLERPP RWS Sbjct: 5 FVSNDAVSNSCSPGDPLVLERPPPRWS 31 >SB_46663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 43 EPSNSCSPGDPLVLERPPPRWS 64 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = -1 Query: 72 EHLK-TCSPGXXLVLERPPXRWS 7 +H+ +CSPG LVLERPP RWS Sbjct: 4 QHISNSCSPGDPLVLERPPPRWS 26 >SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 3 EASNSCSPGDPLVLERPPPRWS 24 >SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 7 EASNSCSPGDPLVLERPPPRWS 28 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 36.7 bits (81), Expect = 0.030 Identities = 18/40 (45%), Positives = 24/40 (60%) Frame = -1 Query: 126 CFLLRPGYIYVFFFVNK*EHLKTCSPGXXLVLERPPXRWS 7 CF+L ++ F++ +CSPG LVLERPP RWS Sbjct: 157 CFVLMGLFMQYELFLSN-----SCSPGDPLVLERPPPRWS 191 >SB_23309| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 24 EGSNSCSPGDPLVLERPPPRWS 45 >SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.7 bits (81), Expect = 0.030 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -1 Query: 78 K*EHLKTCSPGXXLVLERPPXRWS 7 K E +CSPG LVLERPP RWS Sbjct: 16 KLELSNSCSPGDPLVLERPPPRWS 39 >SB_21097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 36.7 bits (81), Expect = 0.030 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -1 Query: 72 EHLKTCSPGXXLVLERPPXRWS 7 E +CSPG LVLERPP RWS Sbjct: 63 ETSNSCSPGDPLVLERPPPRWS 84 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.7 bits (81), Expect = 0.030 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -1 Query: 81 NK*EHLKTCSPGXXLVLERPPXRWS 7 NK +CSPG LVLERPP RWS Sbjct: 15 NKCCRSNSCSPGDPLVLERPPPRWS 39 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 36.7 bits (81), Expect = 0.030 Identities = 16/25 (64%), Positives = 17/25 (68%) Frame = -1 Query: 81 NK*EHLKTCSPGXXLVLERPPXRWS 7 NK +CSPG LVLERPP RWS Sbjct: 41 NKPTISNSCSPGDPLVLERPPPRWS 65 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.039 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -3 Query: 76 MRAFKNLQPGGXTSSRAAXTAVEL 5 M A + LQPGG TSSRAA TAVEL Sbjct: 1 MAAIEFLQPGGSTSSRAAATAVEL 24 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 12 SCSPGDPLVLERPPPRWS 29 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 37 SCSPGDPLVLERPPPRWS 54 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 28 SCSPGDPLVLERPPPRWS 45 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 5 SCSPGDPLVLERPPPRWS 22 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 20 SCSPGDPLVLERPPPRWS 37 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 29 SCSPGDPLVLERPPPRWS 46 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 186 SCSPGDPLVLERPPPRWS 203 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 81 SCSPGDPLVLERPPPRWS 98 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 17 SCSPGDPLVLERPPPRWS 34 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 351 SCSPGDPLVLERPPPRWS 368 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 9 SCSPGDPLVLERPPPRWS 26 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 8 SCSPGDPLVLERPPPRWS 25 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 20 SCSPGDPLVLERPPPRWS 37 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 29 SCSPGDPLVLERPPPRWS 46 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 13 SCSPGDPLVLERPPPRWS 30 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 104 SCSPGDPLVLERPPPRWS 121 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 33 SCSPGDPLVLERPPPRWS 50 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 9 SCSPGDPLVLERPPPRWS 26 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 37 SCSPGDPLVLERPPPRWS 54 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 6 SCSPGDPLVLERPPPRWS 23 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 84 SCSPGDPLVLERPPPRWS 101 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 4 SCSPGDPLVLERPPPRWS 21 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 518 SCSPGDPLVLERPPPRWS 535 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 384 SCSPGDPLVLERPPPRWS 401 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 26 SCSPGDPLVLERPPPRWS 43 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 16 SCSPGDPLVLERPPPRWS 33 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 24 SCSPGDPLVLERPPPRWS 41 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 33 SCSPGDPLVLERPPPRWS 50 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 4 SCSPGDPLVLERPPPRWS 21 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 10 SCSPGDPLVLERPPPRWS 27 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 21 SCSPGDPLVLERPPPRWS 38 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 5 SCSPGDPLVLERPPPRWS 22 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 19 SCSPGDPLVLERPPPRWS 36 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 9 SCSPGDPLVLERPPPRWS 26 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 56 SCSPGDPLVLERPPPRWS 73 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 6 SCSPGDPLVLERPPPRWS 23 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 264 SCSPGDPLVLERPPPRWS 281 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 27 SCSPGDPLVLERPPPRWS 44 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 13 SCSPGDPLVLERPPPRWS 30 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 13 SCSPGDPLVLERPPPRWS 30 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 13 SCSPGDPLVLERPPPRWS 30 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 21 SCSPGDPLVLERPPPRWS 38 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 22 SCSPGDPLVLERPPPRWS 39 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 23 SCSPGDPLVLERPPPRWS 40 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 19 SCSPGDPLVLERPPPRWS 36 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 37 SCSPGDPLVLERPPPRWS 54 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 20 SCSPGDPLVLERPPPRWS 37 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 66 SCSPGDPLVLERPPPRWS 83 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 19 SCSPGDPLVLERPPPRWS 36 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 18 SCSPGDPLVLERPPPRWS 35 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 7 SCSPGDPLVLERPPPRWS 24 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 6 SCSPGDPLVLERPPPRWS 23 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 13 SCSPGDPLVLERPPPRWS 30 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 50 SCSPGDPLVLERPPPRWS 67 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 15 SCSPGDPLVLERPPPRWS 32 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 115 SCSPGDPLVLERPPPRWS 132 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 895 SCSPGDPLVLERPPPRWS 912 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 16 SCSPGDPLVLERPPPRWS 33 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 27 SCSPGDPLVLERPPPRWS 44 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 16 SCSPGDPLVLERPPPRWS 33 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 45 SCSPGDPLVLERPPPRWS 62 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 96 SCSPGDPLVLERPPPRWS 113 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 67 SCSPGDPLVLERPPPRWS 84 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 17 SCSPGDPLVLERPPPRWS 34 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 878 SCSPGDPLVLERPPPRWS 895 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 9 SCSPGDPLVLERPPPRWS 26 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 13 SCSPGDPLVLERPPPRWS 30 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 65 SCSPGDPLVLERPPPRWS 82 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 7 SCSPGDPLVLERPPPRWS 24 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 20 SCSPGDPLVLERPPPRWS 37 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 22 SCSPGDPLVLERPPPRWS 39 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 66 SCSPGDPLVLERPPPRWS 83 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 28 SCSPGDPLVLERPPPRWS 45 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 41 SCSPGDPLVLERPPPRWS 58 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 17 SCSPGDPLVLERPPPRWS 34 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 23 SCSPGDPLVLERPPPRWS 40 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 26 SCSPGDPLVLERPPPRWS 43 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 43 SCSPGDPLVLERPPPRWS 60 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 5 SCSPGDPLVLERPPPRWS 22 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 42 SCSPGDPLVLERPPPRWS 59 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 27 SCSPGDPLVLERPPPRWS 44 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 17 SCSPGDPLVLERPPPRWS 34 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 144 SCSPGDPLVLERPPPRWS 161 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 485 SCSPGDPLVLERPPPRWS 502 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 4 SCSPGDPLVLERPPPRWS 21 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 37 SCSPGDPLVLERPPPRWS 54 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 83 SCSPGDPLVLERPPPRWS 100 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 38 SCSPGDPLVLERPPPRWS 55 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 63 SCSPGDPLVLERPPPRWS 80 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 26 SCSPGDPLVLERPPPRWS 43 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 6 SCSPGDPLVLERPPPRWS 23 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 6 SCSPGDPLVLERPPPRWS 23 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 56 SCSPGDPLVLERPPPRWS 73 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 9 SCSPGDPLVLERPPPRWS 26 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 4 SCSPGDPLVLERPPPRWS 21 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 25 SCSPGDPLVLERPPPRWS 42 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 24 SCSPGDPLVLERPPPRWS 41 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 36 SCSPGDPLVLERPPPRWS 53 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 4 SCSPGDPLVLERPPPRWS 21 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 49 SCSPGDPLVLERPPPRWS 66 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 16 SCSPGDPLVLERPPPRWS 33 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 4 SCSPGDPLVLERPPPRWS 21 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 5 SCSPGDPLVLERPPPRWS 22 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 1024 SCSPGDPLVLERPPPRWS 1041 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 19 SCSPGDPLVLERPPPRWS 36 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 19 SCSPGDPLVLERPPPRWS 36 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 123 SCSPGDPLVLERPPPRWS 140 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 19 SCSPGDPLVLERPPPRWS 36 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 6 SCSPGDPLVLERPPPRWS 23 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 25 SCSPGDPLVLERPPPRWS 42 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 14 SCSPGDPLVLERPPPRWS 31 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 10 SCSPGDPLVLERPPPRWS 27 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 65 SCSPGDPLVLERPPPRWS 82 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 25 SCSPGDPLVLERPPPRWS 42 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 11 SCSPGDPLVLERPPPRWS 28 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 7 SCSPGDPLVLERPPPRWS 24 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 194 SCSPGDPLVLERPPPRWS 211 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 45 SCSPGDPLVLERPPPRWS 62 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 26 SCSPGDPLVLERPPPRWS 43 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 32 SCSPGDPLVLERPPPRWS 49 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 41 SCSPGDPLVLERPPPRWS 58 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 24 SCSPGDPLVLERPPPRWS 41 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 41 SCSPGDPLVLERPPPRWS 58 >SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 18 SCSPGDPLVLERPPPRWS 35 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 19 SCSPGDPLVLERPPPRWS 36 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 62 SCSPGDPLVLERPPPRWS 79 >SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 8 SCSPGDPLVLERPPPRWS 25 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 86 SCSPGDPLVLERPPPRWS 103 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 22 SCSPGDPLVLERPPPRWS 39 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 15 SCSPGDPLVLERPPPRWS 32 >SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 21 SCSPGDPLVLERPPPRWS 38 >SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 7 SCSPGDPLVLERPPPRWS 24 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 6 SCSPGDPLVLERPPPRWS 23 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 21 SCSPGDPLVLERPPPRWS 38 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 12 SCSPGDPLVLERPPPRWS 29 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 53 SCSPGDPLVLERPPPRWS 70 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 43 SCSPGDPLVLERPPPRWS 60 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 13 SCSPGDPLVLERPPPRWS 30 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 11 SCSPGDPLVLERPPPRWS 28 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 120 SCSPGDPLVLERPPPRWS 137 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 69 SCSPGDPLVLERPPPRWS 86 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 244 SCSPGDPLVLERPPPRWS 261 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 15 SCSPGDPLVLERPPPRWS 32 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 187 SCSPGDPLVLERPPPRWS 204 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 6 SCSPGDPLVLERPPPRWS 23 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 10 SCSPGDPLVLERPPPRWS 27 >SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 137 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 17 SCSPGDPLVLERPPPRWS 34 >SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) Length = 608 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 8 SCSPGDPLVLERPPPRWS 25 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 24 SCSPGDPLVLERPPPRWS 41 >SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 11 SCSPGDPLVLERPPPRWS 28 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 25 SCSPGDPLVLERPPPRWS 42 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 20 SCSPGDPLVLERPPPRWS 37 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 37 SCSPGDPLVLERPPPRWS 54 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 66 SCSPGDPLVLERPPPRWS 83 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 59 SCSPGDPLVLERPPPRWS 76 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 59 SCSPGDPLVLERPPPRWS 76 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 19 SCSPGDPLVLERPPPRWS 36 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 11 SCSPGDPLVLERPPPRWS 28 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 1069 SCSPGDPLVLERPPPRWS 1086 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 137 SCSPGDPLVLERPPPRWS 154 >SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 80 SCSPGDPLVLERPPPRWS 97 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 16 SCSPGDPLVLERPPPRWS 33 >SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 7 SCSPGDPLVLERPPPRWS 24 >SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 93 SCSPGDPLVLERPPPRWS 110 >SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 14 SCSPGDPLVLERPPPRWS 31 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 7 SCSPGDPLVLERPPPRWS 24 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 159 SCSPGDPLVLERPPPRWS 176 >SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 5 SCSPGDPLVLERPPPRWS 22 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 23 SCSPGDPLVLERPPPRWS 40 >SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 36 SCSPGDPLVLERPPPRWS 53 >SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 8 SCSPGDPLVLERPPPRWS 25 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 18 SCSPGDPLVLERPPPRWS 35 >SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 9 SCSPGDPLVLERPPPRWS 26 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 55 SCSPGDPLVLERPPPRWS 72 >SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 18 SCSPGDPLVLERPPPRWS 35 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 54 SCSPGDPLVLERPPPRWS 71 >SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) Length = 593 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 139 SCSPGDPLVLERPPPRWS 156 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 8 SCSPGDPLVLERPPPRWS 25 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 14 SCSPGDPLVLERPPPRWS 31 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 19 SCSPGDPLVLERPPPRWS 36 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 82 SCSPGDPLVLERPPPRWS 99 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 105 SCSPGDPLVLERPPPRWS 122 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 74 SCSPGDPLVLERPPPRWS 91 >SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 73 SCSPGDPLVLERPPPRWS 90 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 19 SCSPGDPLVLERPPPRWS 36 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 72 SCSPGDPLVLERPPPRWS 89 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 69 SCSPGDPLVLERPPPRWS 86 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 6 SCSPGDPLVLERPPPRWS 23 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 35 SCSPGDPLVLERPPPRWS 52 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 14 SCSPGDPLVLERPPPRWS 31 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 217 SCSPGDPLVLERPPPRWS 234 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 22 SCSPGDPLVLERPPPRWS 39 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.3 bits (80), Expect = 0.039 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -1 Query: 60 TCSPGXXLVLERPPXRWS 7 +CSPG LVLERPP RWS Sbjct: 11 SCSPGDPLVLERPPPRWS 28 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,118,963 Number of Sequences: 59808 Number of extensions: 162058 Number of successful extensions: 2522 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2522 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 3003134652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -