BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0658 (538 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23C4.12 |hhp2||serine/threonine protein kinase Hhp2 |Schizos... 27 1.3 SPBC3H7.15 |hhp1||serine/threonine protein kinase Hhp1|Schizosac... 27 2.3 SPCC1259.08 |||conserved fungal protein|Schizosaccharomyces pomb... 26 4.1 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 26 4.1 >SPAC23C4.12 |hhp2||serine/threonine protein kinase Hhp2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 400 Score = 27.5 bits (58), Expect = 1.3 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +3 Query: 234 CRGSRPWSSIKSD--KDKFQVNLDVQHFAPEEISVK 335 CRGS PW +++D + K+Q D + P E+ K Sbjct: 208 CRGSLPWQGLQADTKEQKYQRIRDTKIGTPLEVLCK 243 >SPBC3H7.15 |hhp1||serine/threonine protein kinase Hhp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 365 Score = 26.6 bits (56), Expect = 2.3 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +3 Query: 234 CRGSRPWSSIK--SDKDKFQVNLDVQHFAPEEI 326 CRGS PW +K + K K++ ++ + P E+ Sbjct: 209 CRGSLPWQGLKATTKKQKYEKIMEKKISTPTEV 241 >SPCC1259.08 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 394 Score = 25.8 bits (54), Expect = 4.1 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +1 Query: 331 LKRXTATSWLKANTRRRKISMVTYRVNSLVATLCR 435 LKR S+ ANT RK ++V +AT C+ Sbjct: 126 LKRPAKVSFALANTPSRKGNLVPQSPRRTIATTCK 160 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 25.8 bits (54), Expect = 4.1 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -2 Query: 525 PLLAAPPGCELQTTHHLKTAGTPQIQPYSPPA 430 P +A+PP ++ T+H TA ++ P P+ Sbjct: 921 PAIASPPPPKVGETYHPPTASGTRVPPVQQPS 952 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,259,222 Number of Sequences: 5004 Number of extensions: 45536 Number of successful extensions: 106 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 222442660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -