BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0657 (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 1.3 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 1.8 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 4.1 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 4.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.4 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.4 bits (48), Expect = 1.3 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +3 Query: 291 FSEEETREMLRDANVRGDGNVFYESFVESLFSVAPELYEI 410 F+ T+++ +AN +G FY + + ++ E+Y+I Sbjct: 537 FNVNATKQIKDEANKKGVSLRFYNVVYKLIDNIKKEIYDI 576 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 23.0 bits (47), Expect = 1.8 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +2 Query: 167 IRAITVDKFVSFLNLKKFSTQRKEVF*KLRTKNNC 271 +R++ +DK + L +R E R KNNC Sbjct: 313 VRSLVLDKLARIVLLNFQEERRSEPVEPPRRKNNC 347 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 5 KINSNYFFDTMAVLDAYN 58 +I NYFFD+ + +A N Sbjct: 164 EIYPNYFFDSSVIEEAQN 181 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.8 bits (44), Expect = 4.1 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 5 KINSNYFFDTMAVLDAYN 58 +I NYFFD+ + +A N Sbjct: 164 EIYPNYFFDSSVIEEAQN 181 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.6 bits (41), Expect = 9.4 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -2 Query: 222 ENFLRFKKDTNLSTVIALIGSPSVLVS*G 136 + LR KK+ L + G P++L + G Sbjct: 353 QGLLRVKKEEELQEAPSCGGGPTILTTPG 381 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,336 Number of Sequences: 438 Number of extensions: 2120 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -