BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0652 (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g23770.1 68418.m02791 agenet domain-containing protein contai... 29 2.2 At4g03620.1 68417.m00497 myosin heavy chain-related contains wea... 27 9.0 At2g26530.1 68415.m03183 expressed protein 27 9.0 >At5g23770.1 68418.m02791 agenet domain-containing protein contains Pfam PF05641: Agenet domain Length = 438 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 5/48 (10%) Frame = +3 Query: 546 HIQECLNAQRNDARNM-----MNQFLKCLQDIKVQMHEDPISFTLGIS 674 H L R D+R M M F L ++K H DPISF + ++ Sbjct: 290 HFSPLLVESREDSREMSAVGMMLTFFGLLDEVKALQHNDPISFFISLT 337 >At4g03620.1 68417.m00497 myosin heavy chain-related contains weak similarity to Swiss-Prot:P24733 myosin heavy chain, striated muscle [Aequipecten irradians] Length = 342 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/40 (35%), Positives = 26/40 (65%), Gaps = 1/40 (2%) Frame = +2 Query: 371 YEPND-DECLNPWRDDTEEEELARAVQNAAITEGEEKKDD 487 +E N+ +E ++ +R + E+L + VQN A+ +EKK+D Sbjct: 199 HELNEMEELVSDFR--AQNEKLLKKVQNCAVEHNKEKKED 236 >At2g26530.1 68415.m03183 expressed protein Length = 317 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +3 Query: 300 HSNANMKNFTSLFMKSEXXXXXXXXXXXXXNVSTHGVMTLKKKS 431 H+ ++K FTSLF K E +VS H + KK+ Sbjct: 253 HNKDSVKTFTSLFRKQEDTKNSSSRGRGSSSVSAHEFHYMSKKA 296 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,582,493 Number of Sequences: 28952 Number of extensions: 283908 Number of successful extensions: 833 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 833 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -