BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0648 (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56046| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 3e-17 >SB_56046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 674 Score = 85.4 bits (202), Expect = 3e-17 Identities = 39/81 (48%), Positives = 53/81 (65%) Frame = +3 Query: 267 TQEXQLXFCQISFXRYXDDXNRYLYLTEXQDRNXKLFFSLLDCXIEKFMPIVYTPTVGLA 446 +QE Q R +D +Y+ L +RN LFF +L E+ MPIVYTPTVGLA Sbjct: 97 SQEIQAQRVYRELQRKPNDLEKYIQLMALLERNESLFFRVLFDYTEELMPIVYTPTVGLA 156 Query: 447 CQXFGLVYRRPRGLYITIHDK 509 C+ +G+++RRPRGL+I+IHDK Sbjct: 157 CRKYGMIFRRPRGLFISIHDK 177 Score = 33.1 bits (72), Expect = 0.18 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +2 Query: 158 LRGIDHIKDXXXNKGLAFTLEELKL 232 +RG D ++D NKGLAFTLEE ++ Sbjct: 60 IRGTDIMRDSHLNKGLAFTLEERQI 84 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,182,878 Number of Sequences: 59808 Number of extensions: 202205 Number of successful extensions: 236 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 223 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 236 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -