BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0648 (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL110490-11|CAB54452.1| 620|Caenorhabditis elegans Hypothetical... 89 2e-18 >AL110490-11|CAB54452.1| 620|Caenorhabditis elegans Hypothetical protein Y48B6A.12 protein. Length = 620 Score = 89.0 bits (211), Expect = 2e-18 Identities = 40/84 (47%), Positives = 54/84 (64%) Frame = +3 Query: 255 PKFKTQEXQLXFCQISFXRYXDDXNRYLYLTEXQDRNXKLFFSLLDCXIEKFMPIVYTPT 434 P F T+E Q + D+ +Y+ L QDRN KL++ +L +++ MPIVYTPT Sbjct: 82 PAFMTEEQQAYRIITKLRQQPDNLAKYIQLDSLQDRNEKLYYRVLCDNVKELMPIVYTPT 141 Query: 435 VGLACQXFGLVYRRPRGLYITIHD 506 VG ACQ FG +YR P+GLYITI+D Sbjct: 142 VGQACQHFGFIYRNPKGLYITIND 165 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 161 RGIDHIKDXXXNKGLAFTLEE 223 RGID +K NKG+AF+L E Sbjct: 50 RGIDLLKSPGLNKGMAFSLHE 70 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,045,822 Number of Sequences: 27780 Number of extensions: 158816 Number of successful extensions: 212 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 212 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -