BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0647 (628 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.4 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 23 1.8 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 23 3.2 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 9.8 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 1.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 283 QENISLQYFYHDL-FEI*FVYGIKLIIICTV 372 ++N+ + Y D + I F Y I LI++CTV Sbjct: 802 EDNLLVCNSYVDASYMIAFAYPIMLIVVCTV 832 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 23.4 bits (48), Expect = 1.8 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 627 KFGGNVTLNFFFITNKSFLINLSNPSLQICTI 532 K+ GN+TLN +NK +I L+ P C + Sbjct: 109 KYCGNITLNIESTSNKMTVI-LTPPGRFFCEV 139 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 1/23 (4%) Frame = -2 Query: 624 FGGNVTLNFFFITNKSF-LINLS 559 +GGN T+ F I KSF L+N + Sbjct: 128 YGGNSTIIFLLIRFKSFSLLNFN 150 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.0 bits (42), Expect = 9.8 Identities = 8/23 (34%), Positives = 11/23 (47%) Frame = +1 Query: 106 RXRHAGKXACCPACVTLLGEGAT 174 + RH CC C L G G++ Sbjct: 3 KGRHVVMSCCCWCCDNLGGPGSS 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,976 Number of Sequences: 438 Number of extensions: 3780 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -