BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0644 (648 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1YRL7 Cluster: Cationic peptide CP8; n=3; Bombyx|Rep: ... 174 1e-42 UniRef50_A4LA63 Cluster: Cationic peptide CP8; n=1; Manduca sext... 113 5e-24 UniRef50_A0ED71 Cluster: Chromosome undetermined scaffold_9, who... 33 7.9 >UniRef50_A1YRL7 Cluster: Cationic peptide CP8; n=3; Bombyx|Rep: Cationic peptide CP8 - Bombyx mandarina (Wild silk moth) (Wild silkworm) Length = 89 Score = 174 bits (424), Expect = 1e-42 Identities = 76/84 (90%), Positives = 76/84 (90%) Frame = +1 Query: 1 MRCVXAYGALVCGTDYCEKNPCIQXPLVCXXNTEHRXRHAGKXACCPACVTLLGEGATCK 180 MRC AYGALVCGTDYCEKNPCIQ PLVC NTEHR RHAGK ACCPACVTLL EGATCK Sbjct: 1 MRCAAAYGALVCGTDYCEKNPCIQPPLVCPKNTEHRARHAGKCACCPACVTLLDEGATCK 60 Query: 181 IYSKELGETPSAVCKEPLKCIKRV 252 IYSKELGETPSAVCKEPLKCIKRV Sbjct: 61 IYSKELGETPSAVCKEPLKCIKRV 84 >UniRef50_A4LA63 Cluster: Cationic peptide CP8; n=1; Manduca sexta|Rep: Cationic peptide CP8 - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 105 Score = 113 bits (271), Expect = 5e-24 Identities = 48/81 (59%), Positives = 62/81 (76%), Gaps = 3/81 (3%) Frame = +1 Query: 19 YGALVCGTDYCEKNPCIQXPLV---CXXNTEHRXRHAGKXACCPACVTLLGEGATCKIYS 189 YG LVCG++YC+++PC P+ C + +R +HAGK ACCPACVT+LGE A CK YS Sbjct: 18 YGDLVCGSNYCKQHPC-GSPIAQSSCRSPSVYRAKHAGKCACCPACVTMLGENAACKTYS 76 Query: 190 KELGETPSAVCKEPLKCIKRV 252 KELGETPSA+C++PLKC+ V Sbjct: 77 KELGETPSAICRDPLKCLNGV 97 >UniRef50_A0ED71 Cluster: Chromosome undetermined scaffold_9, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_9, whole genome shotgun sequence - Paramecium tetraurelia Length = 3059 Score = 32.7 bits (71), Expect = 7.9 Identities = 22/60 (36%), Positives = 30/60 (50%) Frame = -2 Query: 506 NYTRRVTYIVPIS*QGYLYNTYYFISFLFGLLKIHIF*FQISIFTTVHIIINFIPYTNYI 327 NYT+R TYI+ I Y Y +ISFL + + + Q+ IF +H I I N I Sbjct: 3000 NYTKRFTYII-IQVSVYFYQ---YISFLCQFIIVKVTTLQLVIFDAMHYSIARIKIENRI 3055 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 593,075,409 Number of Sequences: 1657284 Number of extensions: 10936764 Number of successful extensions: 21498 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21487 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48955894634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -