BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0644 (648 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L14644-1|AAB88625.1| 2895|Drosophila melanogaster hyperplastic d... 29 4.1 AE014297-1012|AAF54431.2| 2885|Drosophila melanogaster CG9484-PA... 29 4.1 AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P... 29 7.2 >L14644-1|AAB88625.1| 2895|Drosophila melanogaster hyperplastic discs protein protein. Length = 2895 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/52 (30%), Positives = 21/52 (40%) Frame = +1 Query: 121 GKXACCPACVTLLGEGATCKIYSKELGETPSAVCKEPLKCIKRV*LSLCSRF 276 G CC C + +G CK+ K T C E KC + +L RF Sbjct: 1236 GSLCCCTECARVCHKGHDCKL--KRTAPTAYCDCWEKCKCKALIAGNLTKRF 1285 >AE014297-1012|AAF54431.2| 2885|Drosophila melanogaster CG9484-PA protein. Length = 2885 Score = 29.5 bits (63), Expect = 4.1 Identities = 16/52 (30%), Positives = 21/52 (40%) Frame = +1 Query: 121 GKXACCPACVTLLGEGATCKIYSKELGETPSAVCKEPLKCIKRV*LSLCSRF 276 G CC C + +G CK+ K T C E KC + +L RF Sbjct: 1243 GSLCCCTECARVCHKGHDCKL--KRTAPTAYCDCWEKCKCKALIAGNLTKRF 1292 >AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB protein. Length = 23015 Score = 28.7 bits (61), Expect = 7.2 Identities = 16/61 (26%), Positives = 24/61 (39%) Frame = +1 Query: 58 NPCIQXPLVCXXNTEHRXRHAGKXACCPACVTLLGEGATCKIYSKELGETPSAVCKEPLK 237 +PC+ P C N+E R A + A C +G C+ E P + L+ Sbjct: 10490 DPCVPSP--CGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLR 10547 Query: 238 C 240 C Sbjct: 10548 C 10548 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,903,444 Number of Sequences: 53049 Number of extensions: 520245 Number of successful extensions: 972 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2744900550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -