BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0634 (548 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 27 0.41 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 25 2.2 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 3.8 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 27.1 bits (57), Expect = 0.41 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -3 Query: 342 QRLIQRSSITARGIRRISWASDPVLCQTACLSTATNAAVEA 220 + ++QR + ARG R+ +A D TA S TNA EA Sbjct: 100 EEVMQRIDVLARGHPRVVFAGDLNAWHTAWGSCRTNAKGEA 140 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.6 bits (51), Expect = 2.2 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 159 PSCCSLPQKRD*KERVYSIPSLQRRRWSLCSSKQF 263 PS L R VYS+ RRRWSLC F Sbjct: 9 PSGARLSISRGSPTGVYSV----RRRWSLCQKLHF 39 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.8 bits (49), Expect = 3.8 Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Frame = +3 Query: 204 VYSIPSLQRRRWSLCSSKQFGTTQGRWPKKSAEFLLQLLRNAESNADNKTLDVDRLVI-- 377 + +P+ + W L Q W + E+L L + A+ N + +++ RLVI Sbjct: 1619 IADVPTNRLNHWRLIQKHM----QHIWNRWHREYLSTLQKRAKWNKNAISIEPGRLVILQ 1674 Query: 378 -DHIQVNRAP 404 D++ V++ P Sbjct: 1675 EDNVAVSKWP 1684 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 552,845 Number of Sequences: 2352 Number of extensions: 10330 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -