BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0632 (648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g64170.1 68418.m08057 dentin sialophosphoprotein-related cont... 30 1.2 At3g16600.1 68416.m02122 SNF2 domain-containing protein / helica... 28 4.7 At3g47680.1 68416.m05192 expressed protein contains similarity t... 28 6.1 At2g18700.1 68415.m02178 glycosyl transferase family 20 protein ... 28 6.1 >At5g64170.1 68418.m08057 dentin sialophosphoprotein-related contains weak similarity to Swiss-Prot:Q9NZW4 dentin sialophosphoprotein precursor [Homo sapiens] Length = 566 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 43 LVKEVSLEIESIITSRDVITEI-VRDVVEARGELYRNVAEREENEQGRNEPE 195 +V ++SLE S + VI ++ VR + R LYR E+ G N PE Sbjct: 423 VVDDISLEATSFRQLQQVIEQLDVRTKLCIRDSLYRLAKSAEQRHHGGNRPE 474 >At3g16600.1 68416.m02122 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to SP|P31244 DNA repair protein RAD16 {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 638 Score = 28.3 bits (60), Expect = 4.7 Identities = 13/53 (24%), Positives = 24/53 (45%) Frame = -1 Query: 225 RHGGGXSDAVLGLVPPLFILLSLSNVSVQFSSGFHHVTYDFRDDVTTRDDGLD 67 RH +++ GLV + + L N+ + + H + D + TT D +D Sbjct: 494 RHSTNKDNSISGLVCAMLMSLKAGNLGLNMVAASHVILLDLWWNPTTEDQAID 546 >At3g47680.1 68416.m05192 expressed protein contains similarity to hypothetical proteins of [Arabidopsis thaliana] Length = 302 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 Query: 567 GSEPRGYV*WSXIYSYYG 620 G+E +GY WS I +YYG Sbjct: 72 GNEQKGYAFWSRIAAYYG 89 >At2g18700.1 68415.m02178 glycosyl transferase family 20 protein / trehalose-phosphatase family protein similar to trehalose-6-phosphate synthase SL-TPS/P [Selaginella lepidophylla] GI:4100325; contains Pfam profiles PF00982: Glycosyltransferase family 20, PF02358: Trehalose-phosphatase Length = 862 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = +1 Query: 22 DEEFMPWLVKEVSLEIESIITSRDVITEIVRDVVEAR 132 D F W KE+ +ES++T+ V+ + + +VE + Sbjct: 708 DHSFGSWQAKELLDHLESVLTNEPVVVKRGQHIVEVK 744 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,833,573 Number of Sequences: 28952 Number of extensions: 180251 Number of successful extensions: 532 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -