BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0631 (648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identica... 64 1e-10 >At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identical to cytochrome c oxidase subunit 3 (GI:15215914) [Arabidopsis thaliana]; similar to Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Swiss-Prot:P92514) [Arabidopsis thaliana] Length = 265 Score = 63.7 bits (148), Expect = 1e-10 Identities = 33/77 (42%), Positives = 43/77 (55%) Frame = +1 Query: 286 HRRLSPNIEIGRI*PPSRITPFNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQR 465 H L+P +EIG I PP I +P++IP LNT IL SG VT AHH+++ + Sbjct: 106 HSSLAPAVEIGGIWPPKGIEVLDPWEIPFLNTPILPSSGAAVTWAHHAILAGKEKRAVYA 165 Query: 466 LFLTILLGFYFTILQHM 516 L T+LL FT Q M Sbjct: 166 LVATVLLALVFTGFQGM 182 Score = 60.9 bits (141), Expect = 7e-10 Identities = 27/54 (50%), Positives = 34/54 (62%) Frame = +3 Query: 465 IIFNYFIRILFYYFTAYEYIXASFTIADRIYGSTXFIATGFHGIHVIIGNFISI 626 ++ + ++F F EY A FTI+D IYGST F+ATGFHG HVIIG I Sbjct: 166 LVATVLLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLI 219 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,575,239 Number of Sequences: 28952 Number of extensions: 137658 Number of successful extensions: 230 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 226 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 230 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -