BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0625 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0845 - 28155065-28155374,28156201-28156342,28156375-281565... 30 1.2 12_02_0876 - 23926691-23928090,23928184-23928919,23929048-23929272 29 2.1 11_06_0183 - 20999343-20999865,21000351-21000748 29 2.8 11_06_0667 + 26071774-26072070,26072352-26073153,26073209-260734... 28 4.9 05_04_0065 - 17617084-17617183,17617587-17617626,17618323-17618500 28 4.9 04_04_1100 + 30894575-30895012,30896082-30897044 28 4.9 02_03_0164 - 15862166-15862366,15862443-15862508,15862754-158630... 28 4.9 05_03_0274 - 11372054-11372347 28 6.5 10_02_0074 - 4965688-4966638,4966877-4966906,4968656-4968927,496... 27 8.6 07_03_1557 - 27699675-27699972,27700546-27700630,27700741-277008... 27 8.6 03_05_0026 + 19966616-19966703,19967992-19968058,19968599-199686... 27 8.6 01_03_0017 + 11677029-11677100,11677992-11678030,11678169-116783... 27 8.6 >03_05_0845 - 28155065-28155374,28156201-28156342,28156375-28156505, 28156591-28156784,28156859-28156969,28157234-28157399, 28157501-28157668,28157766-28158787 Length = 747 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/28 (46%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -2 Query: 594 IEGSGQIIYPS-YRYHGSWVKGMPKGTG 514 I G G +I+ + RY G W G+P+GTG Sbjct: 165 ISGRGVLIWANGSRYDGVWENGVPRGTG 192 >12_02_0876 - 23926691-23928090,23928184-23928919,23929048-23929272 Length = 786 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +2 Query: 32 QIVPLEWPKLKKNLINITFQHYLPTSNPSAQ 124 Q V + W K + N IN + HYLP NP Q Sbjct: 322 QNVSMGWFKQEPNGINFSAAHYLPRCNPFNQ 352 >11_06_0183 - 20999343-20999865,21000351-21000748 Length = 306 Score = 29.1 bits (62), Expect = 2.8 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -3 Query: 191 PEYEGQDDNDSWLLHRQKFLEETEQK 114 P+++G+DD +WL H ++F TE + Sbjct: 94 PKFDGKDDPLNWLNHCEQFFFRTENR 119 >11_06_0667 + 26071774-26072070,26072352-26073153,26073209-26073411, 26075078-26075521,26075703-26075758,26076323-26076402, 26077098-26077174,26077279-26078301 Length = 993 Score = 28.3 bits (60), Expect = 4.9 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 169 IMILGCCTGKSSWRKLSRRIRCWE 98 I + GCCT + RK+ I CW+ Sbjct: 208 IRLFGCCTERQYKRKIKLSIWCWK 231 >05_04_0065 - 17617084-17617183,17617587-17617626,17618323-17618500 Length = 105 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +1 Query: 214 TKRSVSTLSFVRDGSNRVPAEELVQEARTPPCMQSRCVLAKLRFYLK 354 T+ V T + DGS+++ A + + RT + LAKLR L+ Sbjct: 8 TRTRVGTSRGIDDGSSKLRASSMTVDTRTQLSSAASTTLAKLRAMLR 54 >04_04_1100 + 30894575-30895012,30896082-30897044 Length = 466 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 264 CTGRGTGSGGKNSAMYAVTLRARQTEIL 347 C G G GSGG + + A TL+A ++L Sbjct: 53 CYGAGEGSGGGGALLPAATLKAALAKVL 80 >02_03_0164 - 15862166-15862366,15862443-15862508,15862754-15863029, 15864869-15864989,15865091-15865368 Length = 313 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 274 EELVQEARTPPCMQSRCVLAKLR 342 + L+ +R PP S+CVLA+LR Sbjct: 51 QSLLSASRPPPLFTSKCVLAELR 73 >05_03_0274 - 11372054-11372347 Length = 97 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +3 Query: 234 TFVCQGWIESCTGRGTGSGGK 296 +F+ GW E+ T G GSGG+ Sbjct: 20 SFLGSGWDEAATNEGIGSGGR 40 >10_02_0074 - 4965688-4966638,4966877-4966906,4968656-4968927, 4969092-4969329 Length = 496 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = -3 Query: 230 ETDLLVFEPPSLAPEYEGQDDNDSWLLHRQKFLEETEQKD 111 E D++ F+P L +Y+G +N W + +T++KD Sbjct: 67 EVDIMSFDPVKLIEKYKGYGEN-RWYFFTVRKPSKTKKKD 105 >07_03_1557 - 27699675-27699972,27700546-27700630,27700741-27700847, 27700942-27701135,27701252-27701368,27701466-27701631, 27701723-27701887,27702185-27703428 Length = 791 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 594 IEGSGQIIYPS-YRYHGSWVKGMPKGTG 514 I G G +++ + RY G W G P+G G Sbjct: 197 IHGRGALVWSNGNRYDGGWEDGCPRGQG 224 >03_05_0026 + 19966616-19966703,19967992-19968058,19968599-19968677, 19969140-19969231,19969961-19970396,19973749-19974099 Length = 370 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 244 QTKVWKQTFWCSNHH 200 QTKVWK T SNHH Sbjct: 76 QTKVWKMTKLPSNHH 90 >01_03_0017 + 11677029-11677100,11677992-11678030,11678169-11678341, 11679068-11679284,11679518-11679688,11679781-11679941, 11680025-11681069,11681320-11681466,11681547-11681774, 11681863-11682020,11682124-11682493 Length = 926 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +2 Query: 44 LEWPKLKKNLINITFQHYLPTSNPSAQFPPRTFACATTKNHYRLDLRTLGLKMVVRTP 217 LE +L + L+ +++ H P S F PR AC T + R+ + L L+ R P Sbjct: 265 LEALELSRCLLLMSYIHGSPLLESSKAFSPREAACVTASSLGRVLMLDLILRNEDRLP 322 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,603,929 Number of Sequences: 37544 Number of extensions: 278326 Number of successful extensions: 801 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 789 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -