BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0625 (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 4.3 CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein... 23 7.5 AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. 23 7.5 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 4.3 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 206 PPSLAPEYEGQDDNDS 159 P SLAP++EG DNDS Sbjct: 562 PKSLAPDHEG--DNDS 575 >CR954257-13|CAJ14164.1| 420|Anopheles gambiae predicted protein protein. Length = 420 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -3 Query: 257 DPSLTNESVETDLLVFEPPSLAPEYEGQDDNDSWLLHRQKFLEETEQK 114 DP++ ++VE D+ E +L +YE Q +Q+ +E+ +K Sbjct: 90 DPTVCWDTVELDVPRAERATLKQQYEEQHRKRLEQQSKQRAIEKDRKK 137 >AY428512-1|AAR89530.1| 420|Anopheles gambiae EKN1 protein. Length = 420 Score = 23.0 bits (47), Expect = 7.5 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -3 Query: 257 DPSLTNESVETDLLVFEPPSLAPEYEGQDDNDSWLLHRQKFLEETEQK 114 DP++ ++VE D+ E +L +YE Q +Q+ +E+ +K Sbjct: 90 DPTVCWDTVELDVPRAERATLKQQYEEQHRKRLEQQSKQRAIEKDRKK 137 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 565,224 Number of Sequences: 2352 Number of extensions: 9547 Number of successful extensions: 13 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -