BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0620 (578 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48650.1 68414.m05445 helicase domain-containing protein cont... 27 6.8 At1g64670.1 68414.m07331 hydrolase, alpha/beta fold family prote... 27 9.0 >At1g48650.1 68414.m05445 helicase domain-containing protein contains similarity to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain, PF00035: Double-stranded RNA binding motif Length = 1197 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 98 MTAITRANARRPFILPFDDAFLCEAGGSR 12 MT + + R PF++PFD L E S+ Sbjct: 810 MTVVAGLSVRDPFLMPFDKKDLAETARSK 838 >At1g64670.1 68414.m07331 hydrolase, alpha/beta fold family protein low similarity to 2-hydroxy-6-oxo-7-methylocta-2,4-dienoate hydrolase [Pseudomonas putida] GI:2822275; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 469 Score = 27.1 bits (57), Expect = 9.0 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -2 Query: 319 VFILFIRDLVEKVVNSGYFCLMYRFSSKLSDIPCSMCSASEMSP 188 VF+ FI D+V+ ++ Y L + F S+ PC C E P Sbjct: 13 VFVFFILDIVDFLLCFTYKTLDFFFESEWK--PCYCCPPPEAKP 54 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,860,583 Number of Sequences: 28952 Number of extensions: 182486 Number of successful extensions: 425 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1131744440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -