BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0618 (449 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC002764-1|AAH02764.2| 528|Homo sapiens Wolf-Hirschhorn syndrom... 29 9.7 AL132868-2|CAM15219.1| 539|Homo sapiens Wolf-Hirschhorn syndrom... 29 9.7 AF131751-1|AAD20034.1| 265|Homo sapiens human Wolf-Hirschhorn s... 29 9.7 AF101434-1|AAC72982.1| 525|Homo sapiens Wolf-Hirschhorn syndrom... 29 9.7 AB044549-1|BAB18651.1| 549|Homo sapiens Wolf-Hirshhorn syndrome... 29 9.7 >BC002764-1|AAH02764.2| 528|Homo sapiens Wolf-Hirschhorn syndrome candidate 2 protein. Length = 528 Score = 28.7 bits (61), Expect = 9.7 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +1 Query: 184 SGAKDGGSNTKXSVSTLSFVRDGMNRVPAEELVQEARTPPCMQSRCVARQTE 339 S K G N + ++ + S++ + VPA + + TPP SR +R E Sbjct: 306 STQKLGSLNNEPALPSTSYLPSTPSVVPASSYIPSSETPPAPSSREASRPPE 357 >AL132868-2|CAM15219.1| 539|Homo sapiens Wolf-Hirschhorn syndrome candidate 2 protein. Length = 539 Score = 28.7 bits (61), Expect = 9.7 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +1 Query: 184 SGAKDGGSNTKXSVSTLSFVRDGMNRVPAEELVQEARTPPCMQSRCVARQTE 339 S K G N + ++ + S++ + VPA + + TPP SR +R E Sbjct: 317 STQKLGSLNNEPALPSTSYLPSTPSVVPASSYIPSSETPPAPSSREASRPPE 368 >AF131751-1|AAD20034.1| 265|Homo sapiens human Wolf-Hirschhorn syndrome candidate 2 protein protein. Length = 265 Score = 28.7 bits (61), Expect = 9.7 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +1 Query: 184 SGAKDGGSNTKXSVSTLSFVRDGMNRVPAEELVQEARTPPCMQSRCVARQTE 339 S K G N + ++ + S++ + VPA + + TPP SR +R E Sbjct: 43 STQKLGSLNNEPALPSTSYLPSTPSVVPASSYIPSSETPPAPSSREASRPPE 94 >AF101434-1|AAC72982.1| 525|Homo sapiens Wolf-Hirschhorn syndrome candidate 2 protein protein. Length = 525 Score = 28.7 bits (61), Expect = 9.7 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +1 Query: 184 SGAKDGGSNTKXSVSTLSFVRDGMNRVPAEELVQEARTPPCMQSRCVARQTE 339 S K G N + ++ + S++ + VPA + + TPP SR +R E Sbjct: 303 STQKLGSLNNEPALPSTSYLPSTPSVVPASSYIPSSETPPAPSSREASRPPE 354 >AB044549-1|BAB18651.1| 549|Homo sapiens Wolf-Hirshhorn syndrome candidate 2 protein protein. Length = 549 Score = 28.7 bits (61), Expect = 9.7 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +1 Query: 184 SGAKDGGSNTKXSVSTLSFVRDGMNRVPAEELVQEARTPPCMQSRCVARQTE 339 S K G N + ++ + S++ + VPA + + TPP SR +R E Sbjct: 327 STQKLGSLNNEPALPSTSYLPSTPSVVPASSYIPSSETPPAPSSREASRPPE 378 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,868,312 Number of Sequences: 237096 Number of extensions: 969693 Number of successful extensions: 1939 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1899 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1939 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3701294870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -