BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0612 (409 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36537| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) 27 7.8 >SB_36537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 26.6 bits (56), Expect = 7.8 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 397 WWLAEKXSRF*DLSDVPNWAGSFNGNRWW 311 WW+ E + D+PN G F ++WW Sbjct: 104 WWIYETP-----MVDLPNTNGGFTKHQWW 127 >SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) Length = 1079 Score = 26.6 bits (56), Expect = 7.8 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +3 Query: 105 KLFLLSVRMHRSHXSKNQIXNMRPMILEDKTAFTSLTNDDSEQQQKPVEEHRRSGHR 275 K+F + + + + + N + M + +K S D+E + P + HRR HR Sbjct: 790 KIFEMDAKKEQENGNTNDEEELEDMSMAEKPGSQS----DNELNRPPQDRHRRHHHR 842 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,255,533 Number of Sequences: 59808 Number of extensions: 162086 Number of successful extensions: 326 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 326 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -