BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0612 (409 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z50797-1|CAA90671.1| 206|Caenorhabditis elegans Hypothetical pr... 28 3.0 U39997-9|AAA81101.2| 468|Caenorhabditis elegans Hypothetical pr... 26 9.1 AL117195-12|CAB60765.1| 425|Caenorhabditis elegans Hypothetical... 26 9.1 >Z50797-1|CAA90671.1| 206|Caenorhabditis elegans Hypothetical protein T22H6.1 protein. Length = 206 Score = 27.9 bits (59), Expect = 3.0 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +3 Query: 27 KENQKNRFKIFSNYMKK 77 K N++N FK+FSNY+ + Sbjct: 43 KYNEENHFKVFSNYLNR 59 >U39997-9|AAA81101.2| 468|Caenorhabditis elegans Hypothetical protein F56D1.1 protein. Length = 468 Score = 26.2 bits (55), Expect = 9.1 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +3 Query: 210 LTNDDSEQQQKPVEEHRRSGH 272 +++DD EQQQK +E+H + H Sbjct: 215 VSDDDPEQQQKDLEDHVQRIH 235 >AL117195-12|CAB60765.1| 425|Caenorhabditis elegans Hypothetical protein Y57A10A.19 protein. Length = 425 Score = 26.2 bits (55), Expect = 9.1 Identities = 14/57 (24%), Positives = 28/57 (49%) Frame = +3 Query: 105 KLFLLSVRMHRSHXSKNQIXNMRPMILEDKTAFTSLTNDDSEQQQKPVEEHRRSGHR 275 KL + R + + ++ + + +++ A +S D + Q+KP E+ RRS R Sbjct: 221 KLKEMEKRREKLRQKERELLAVSDKVKKEEPAESSDEEDSRKDQRKPREDRRRSVER 277 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,664,775 Number of Sequences: 27780 Number of extensions: 121618 Number of successful extensions: 336 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 336 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 651753158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -