BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0611 (638 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.4 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 23 3.3 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 22 4.4 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 22 4.4 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 22 4.4 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 22 4.4 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 22 4.4 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 22 4.4 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 22 4.4 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 22 4.4 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 22 4.4 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 4.4 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 4.4 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 1.4 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 283 QENISLQYFYHDL-FEI*FVYGIKLIIICTV 372 ++N+ + Y D + I F Y I LI++CTV Sbjct: 802 EDNLLVCNSYVDASYMIAFAYPIMLIVVCTV 832 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 169 HLHQVKLHKRDNKHTFQRVWXDAQ 98 ++ +VK K +KH Q W D + Sbjct: 325 YIPKVKNKKAGSKHLLQNTWLDPE 348 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 542 NLHNY*RLMRIYNYTRRVTYIVPI 471 N HNY +L NY ++ VP+ Sbjct: 102 NKHNYNKLYYNINYIEQIPIPVPV 125 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 542 NLHNY*RLMRIYNYTRRVTYIVPI 471 N HNY +L NY ++ VP+ Sbjct: 102 NKHNYNKLYYNINYIEQIPIPVPV 125 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 542 NLHNY*RLMRIYNYTRRVTYIVPI 471 N HNY +L NY ++ VP+ Sbjct: 102 NKHNYNKLYYNINYIEQIPIPVPV 125 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 542 NLHNY*RLMRIYNYTRRVTYIVPI 471 N HNY +L NY ++ VP+ Sbjct: 102 NKHNYNKLYYNINYIEQIPIPVPV 125 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 542 NLHNY*RLMRIYNYTRRVTYIVPI 471 N HNY +L NY ++ VP+ Sbjct: 102 NKHNYNKLYYNINYIEQIPIPVPV 125 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 542 NLHNY*RLMRIYNYTRRVTYIVPI 471 N HNY +L NY ++ VP+ Sbjct: 102 NKHNYNKLYYNINYIEQIPIPVPV 125 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 542 NLHNY*RLMRIYNYTRRVTYIVPI 471 N HNY +L NY ++ VP+ Sbjct: 102 NKHNYNKLYYNINYIEQIPIPVPV 125 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 542 NLHNY*RLMRIYNYTRRVTYIVPI 471 N HNY +L NY ++ VP+ Sbjct: 102 NKHNYNKLYYNINYIEQIPIPVPV 125 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 542 NLHNY*RLMRIYNYTRRVTYIVPI 471 N HNY +L NY ++ VP+ Sbjct: 102 NKHNYNKLYYNINYIEQIPIPVPV 125 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 542 NLHNY*RLMRIYNYTRRVTYIVPI 471 N HNY +L NY ++ VP+ Sbjct: 335 NKHNYNKLYYNINYIEQIPIPVPV 358 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 542 NLHNY*RLMRIYNYTRRVTYIVPI 471 N HNY +L NY ++ VP+ Sbjct: 335 NKHNYNKLYYNINYIEQIPIPVPV 358 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,070 Number of Sequences: 438 Number of extensions: 4023 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -