BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0610 (499 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC001103-1|AAH01103.1| 167|Homo sapiens GULP1 protein protein. 39 0.011 AF200715-1|AAF08006.1| 304|Homo sapiens PTB domain adaptor prot... 39 0.011 AF191771-1|AAF18975.1| 304|Homo sapiens CED-6 protein protein. 39 0.011 AC125490-1|AAY24122.1| 123|Homo sapiens unknown protein. 39 0.011 Y09847-1|CAA70977.1| 583|Homo sapiens shc p66 protein. 30 3.9 X68148-1|CAA48251.1| 473|Homo sapiens SHC transforming protein ... 30 3.9 U73377-1|AAB49972.1| 583|Homo sapiens p66shc protein. 30 3.9 BC014158-1|AAH14158.1| 474|Homo sapiens SHC (Src homology 2 dom... 30 3.9 AL451085-16|CAI13253.1| 137|Homo sapiens SHC (Src homology 2 do... 30 3.9 AL451085-15|CAI13252.1| 200|Homo sapiens SHC (Src homology 2 do... 30 3.9 AL451085-14|CAI13250.1| 583|Homo sapiens SHC (Src homology 2 do... 30 3.9 AL451085-13|CAI13248.1| 474|Homo sapiens SHC (Src homology 2 do... 30 3.9 AL451085-12|CAI13249.1| 473|Homo sapiens SHC (Src homology 2 do... 30 3.9 AL451085-11|CAI13251.1| 584|Homo sapiens SHC (Src homology 2 do... 30 3.9 >BC001103-1|AAH01103.1| 167|Homo sapiens GULP1 protein protein. Length = 167 Score = 38.7 bits (86), Expect = 0.011 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQPK 464 + W+H P++L + Y KFLG T+V+QPK Sbjct: 11 KTWMHTPEALSKHFIPYNAKFLGSTEVEQPK 41 >AF200715-1|AAF08006.1| 304|Homo sapiens PTB domain adaptor protein CED-6 protein. Length = 304 Score = 38.7 bits (86), Expect = 0.011 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQPK 464 + W+H P++L + Y KFLG T+V+QPK Sbjct: 11 KTWMHTPEALSKHFIPYNAKFLGSTEVEQPK 41 >AF191771-1|AAF18975.1| 304|Homo sapiens CED-6 protein protein. Length = 304 Score = 38.7 bits (86), Expect = 0.011 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQPK 464 + W+H P++L + Y KFLG T+V+QPK Sbjct: 11 KTWMHTPEALSKHFIPYNAKFLGSTEVEQPK 41 >AC125490-1|AAY24122.1| 123|Homo sapiens unknown protein. Length = 123 Score = 38.7 bits (86), Expect = 0.011 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQPK 464 + W+H P++L + Y KFLG T+V+QPK Sbjct: 1 KTWMHTPEALSKHFIPYNAKFLGSTEVEQPK 31 >Y09847-1|CAA70977.1| 583|Homo sapiens shc p66 protein. Length = 583 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQ 458 R W+H D ++ V+YLV+++G +V Q Sbjct: 146 RGWLHPNDKVMGPGVSYLVRYMGCVEVLQ 174 >X68148-1|CAA48251.1| 473|Homo sapiens SHC transforming protein protein. Length = 473 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQ 458 R W+H D ++ V+YLV+++G +V Q Sbjct: 36 RGWLHPNDKVMGPGVSYLVRYMGCVEVLQ 64 >U73377-1|AAB49972.1| 583|Homo sapiens p66shc protein. Length = 583 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQ 458 R W+H D ++ V+YLV+++G +V Q Sbjct: 146 RGWLHPNDKVMGPGVSYLVRYMGCVEVLQ 174 >BC014158-1|AAH14158.1| 474|Homo sapiens SHC (Src homology 2 domain containing) transforming protein 1 protein. Length = 474 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQ 458 R W+H D ++ V+YLV+++G +V Q Sbjct: 36 RGWLHPNDKVMGPGVSYLVRYMGCVEVLQ 64 >AL451085-16|CAI13253.1| 137|Homo sapiens SHC (Src homology 2 domain containing) transforming protein 1 protein. Length = 137 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQ 458 R W+H D ++ V+YLV+++G +V Q Sbjct: 36 RGWLHPNDKVMGPGVSYLVRYMGCVEVLQ 64 >AL451085-15|CAI13252.1| 200|Homo sapiens SHC (Src homology 2 domain containing) transforming protein 1 protein. Length = 200 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQ 458 R W+H D ++ V+YLV+++G +V Q Sbjct: 36 RGWLHPNDKVMGPGVSYLVRYMGCVEVLQ 64 >AL451085-14|CAI13250.1| 583|Homo sapiens SHC (Src homology 2 domain containing) transforming protein 1 protein. Length = 583 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQ 458 R W+H D ++ V+YLV+++G +V Q Sbjct: 146 RGWLHPNDKVMGPGVSYLVRYMGCVEVLQ 174 >AL451085-13|CAI13248.1| 474|Homo sapiens SHC (Src homology 2 domain containing) transforming protein 1 protein. Length = 474 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQ 458 R W+H D ++ V+YLV+++G +V Q Sbjct: 36 RGWLHPNDKVMGPGVSYLVRYMGCVEVLQ 64 >AL451085-12|CAI13249.1| 473|Homo sapiens SHC (Src homology 2 domain containing) transforming protein 1 protein. Length = 473 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQ 458 R W+H D ++ V+YLV+++G +V Q Sbjct: 36 RGWLHPNDKVMGPGVSYLVRYMGCVEVLQ 64 >AL451085-11|CAI13251.1| 584|Homo sapiens SHC (Src homology 2 domain containing) transforming protein 1 protein. Length = 584 Score = 30.3 bits (65), Expect = 3.9 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 372 RNWIHAPDSLVXGHVAYLVKFLGXTQVDQ 458 R W+H D ++ V+YLV+++G +V Q Sbjct: 146 RGWLHPNDKVMGPGVSYLVRYMGCVEVLQ 174 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 48,758,848 Number of Sequences: 237096 Number of extensions: 686897 Number of successful extensions: 831 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 829 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 831 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4536472160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -