BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0610 (499 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119596-1|AAM50250.1| 517|Drosophila melanogaster LD19266p pro... 53 2e-07 AF204777-1|AAF22653.1| 517|Drosophila melanogaster CED-6 protein. 53 2e-07 AE013599-865|AAM71067.1| 517|Drosophila melanogaster CG11804-PC... 53 2e-07 AE013599-864|AAF58937.1| 517|Drosophila melanogaster CG11804-PB... 53 2e-07 AE013599-863|AAG22292.1| 517|Drosophila melanogaster CG11804-PA... 53 2e-07 AY060371-1|AAL25410.1| 503|Drosophila melanogaster LD23637p pro... 29 4.6 AE014297-3670|AAF56367.1| 863|Drosophila melanogaster CG11168-P... 29 4.6 >AY119596-1|AAM50250.1| 517|Drosophila melanogaster LD19266p protein. Length = 517 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +3 Query: 360 AXNG-RNWIHAPDSLVXGHVAYLVKFLGXTQVDQPK 464 A NG RNW+H P+ L+ GH YLVKF G VDQPK Sbjct: 68 AKNGKRNWLHTPEQLISGHAVYLVKFFGNLSVDQPK 103 >AF204777-1|AAF22653.1| 517|Drosophila melanogaster CED-6 protein. Length = 517 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +3 Query: 360 AXNG-RNWIHAPDSLVXGHVAYLVKFLGXTQVDQPK 464 A NG RNW+H P+ L+ GH YLVKF G VDQPK Sbjct: 68 AKNGKRNWLHTPEQLISGHAVYLVKFFGNLSVDQPK 103 >AE013599-865|AAM71067.1| 517|Drosophila melanogaster CG11804-PC, isoform C protein. Length = 517 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +3 Query: 360 AXNG-RNWIHAPDSLVXGHVAYLVKFLGXTQVDQPK 464 A NG RNW+H P+ L+ GH YLVKF G VDQPK Sbjct: 68 AKNGKRNWLHTPEQLISGHAVYLVKFFGNLSVDQPK 103 >AE013599-864|AAF58937.1| 517|Drosophila melanogaster CG11804-PB, isoform B protein. Length = 517 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +3 Query: 360 AXNG-RNWIHAPDSLVXGHVAYLVKFLGXTQVDQPK 464 A NG RNW+H P+ L+ GH YLVKF G VDQPK Sbjct: 68 AKNGKRNWLHTPEQLISGHAVYLVKFFGNLSVDQPK 103 >AE013599-863|AAG22292.1| 517|Drosophila melanogaster CG11804-PA, isoform A protein. Length = 517 Score = 53.2 bits (122), Expect = 2e-07 Identities = 22/36 (61%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = +3 Query: 360 AXNG-RNWIHAPDSLVXGHVAYLVKFLGXTQVDQPK 464 A NG RNW+H P+ L+ GH YLVKF G VDQPK Sbjct: 68 AKNGKRNWLHTPEQLISGHAVYLVKFFGNLSVDQPK 103 >AY060371-1|AAL25410.1| 503|Drosophila melanogaster LD23637p protein. Length = 503 Score = 28.7 bits (61), Expect = 4.6 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 375 NWIHAPDSLVXGHVAYLVKFLGXTQV 452 NW H+P + + G + Y + +LG T + Sbjct: 329 NWCHSPYTFIYGEIRYSLFYLGSTVI 354 >AE014297-3670|AAF56367.1| 863|Drosophila melanogaster CG11168-PA protein. Length = 863 Score = 28.7 bits (61), Expect = 4.6 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 375 NWIHAPDSLVXGHVAYLVKFLGXTQV 452 NW H+P + + G + Y + +LG T + Sbjct: 689 NWCHSPYTFIYGEIRYSLFYLGSTVI 714 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,141,208 Number of Sequences: 53049 Number of extensions: 198296 Number of successful extensions: 635 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 633 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1763278080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -