BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0608 (578 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL110490-11|CAB54452.1| 620|Caenorhabditis elegans Hypothetical... 83 1e-16 Z74474-2|CAA98955.1| 425|Caenorhabditis elegans Hypothetical pr... 29 3.2 Z81500-2|CAB04096.1| 394|Caenorhabditis elegans Hypothetical pr... 28 5.5 >AL110490-11|CAB54452.1| 620|Caenorhabditis elegans Hypothetical protein Y48B6A.12 protein. Length = 620 Score = 83.4 bits (197), Expect = 1e-16 Identities = 39/84 (46%), Positives = 51/84 (60%) Frame = +3 Query: 255 PKFKTQEEQLEFCQISFXXXXXXXXXXXXXTELQDRNEKLFFSLLDCDIEKFMPIVYTPT 434 P F T+E+Q LQDRNEKL++ +L ++++ MPIVYTPT Sbjct: 82 PAFMTEEQQAYRIITKLRQQPDNLAKYIQLDSLQDRNEKLYYRVLCDNVKELMPIVYTPT 141 Query: 435 VGLACQKFGLVYRRPRGLYITIHD 506 VG ACQ FG +YR P+GLYITI+D Sbjct: 142 VGQACQHFGFIYRNPKGLYITIND 165 Score = 33.5 bits (73), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 161 RGIDHIKDPRLNKGLAFTLEE 223 RGID +K P LNKG+AF+L E Sbjct: 50 RGIDLLKSPGLNKGMAFSLHE 70 Score = 30.7 bits (66), Expect = 0.78 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +1 Query: 523 ILKNWPEHAVRAIVFTDG 576 IL NWP VRAIV TDG Sbjct: 174 ILANWPTENVRAIVITDG 191 >Z74474-2|CAA98955.1| 425|Caenorhabditis elegans Hypothetical protein K10C8.2 protein. Length = 425 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = -3 Query: 195 LSRGSFIWSMPLSMFGQIMLPVISCIFLLWSKYLG-CKPFIILRLN 61 LS +W PL+ G + + V I + +YLG C PF+I R++ Sbjct: 94 LSVQLIVWFYPLAQIG-LTMSVYVTILVSVHRYLGVCHPFLIRRIS 138 >Z81500-2|CAB04096.1| 394|Caenorhabditis elegans Hypothetical protein F11D11.3 protein. Length = 394 Score = 27.9 bits (59), Expect = 5.5 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -3 Query: 396 HNQVN*KIVFHSYLATQSNKGIYSNRRHIY 307 HN++N + FH YL+ QS+ YS R I+ Sbjct: 33 HNEINVEAPFHMYLSAQSDS--YSILRQIF 60 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,000,471 Number of Sequences: 27780 Number of extensions: 229427 Number of successful extensions: 467 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 467 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1205362812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -