BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0602 (508 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 25 0.29 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 24 0.90 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 22 2.7 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 6.3 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 25.4 bits (53), Expect = 0.29 Identities = 9/27 (33%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = -3 Query: 152 CCTGKSSWRKLSRRIRCWEIMLK--CN 78 C G + W + RCWE+ + CN Sbjct: 518 CSLGINPWANCTASTRCWEVFMDGICN 544 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.8 bits (49), Expect = 0.90 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -1 Query: 310 HTWRSSCLLNQFLCRYTIRTIPDKRKCGNRPFGVRTTIFS 191 H W+ + + RY R++ D + G RP RTT+ S Sbjct: 227 HKWKKNDSSKK-KTRYYYRSVDDVIEKGKRPGAFRTTLGS 265 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 241 CQGWYESCTGRGTGSGGKNSA 303 C ESC G GS G+NSA Sbjct: 15 CDDEVESCIAVGVGS-GRNSA 34 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.0 bits (42), Expect = 6.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 48 TLTERFVVYCNIFIE 4 TLT F +CN+ +E Sbjct: 424 TLTGPFFTFCNVLME 438 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,234 Number of Sequences: 336 Number of extensions: 1921 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12049355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -