BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0602 (508 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyc... 29 0.30 SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual 27 2.1 SPAC29A4.17c |||FUN14 family protein|Schizosaccharomyces pombe|c... 26 2.8 SPBC1711.05 |||nucleocytoplasmic transport chaperone Srp40 |Schi... 25 6.5 SPBC1706.01 |tea4|wsh3|tip elongation aberrant protein Tea4|Schi... 25 6.5 >SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 898 Score = 29.5 bits (63), Expect = 0.30 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = +3 Query: 48 WPKLKKNLINITFQHYLPTSNPSAQFPPRTFACATTKNHYRLDLRTLGLKMVVRT 212 WPKL+KN+ IT + T S F P ++ H +LDLR + VR+ Sbjct: 746 WPKLRKNIRKITKPNGFTTDQHSQTFIP-------SQTHTKLDLRLSDVTDSVRS 793 >SPBC1604.15 |gpi16||pig-T |Schizosaccharomyces pombe|chr 2|||Manual Length = 545 Score = 26.6 bits (56), Expect = 2.1 Identities = 14/52 (26%), Positives = 19/52 (36%) Frame = +3 Query: 78 ITFQHYLPTSNPSAQFPPRTFACATTKNHYRLDLRTLGLKMVVRTPKGLFPH 233 + Y P +N PP + N LRT L M + TP P+ Sbjct: 441 LRLDEYPPDANRGYNLPPAIISVFDENNTKLCSLRTAALLMFIPTPDFSMPY 492 >SPAC29A4.17c |||FUN14 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 147 Score = 26.2 bits (55), Expect = 2.8 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 7/51 (13%) Frame = +3 Query: 15 YYNRQQIVPLEWPKLKKNLINITFQH---YLPTS---NPSAQFPP-RTFAC 146 Y N + ++ + WP+L++ +I T Q+ + P+S N + FP R + C Sbjct: 77 YINSKGLIRINWPQLQQQVIGPTEQYTGFHFPSSGRFNTQSTFPTIRNWIC 127 >SPBC1711.05 |||nucleocytoplasmic transport chaperone Srp40 |Schizosaccharomyces pombe|chr 2|||Manual Length = 451 Score = 25.0 bits (52), Expect = 6.5 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +2 Query: 149 NNQESLSS*PSYSGAKDGGSNTKRSVSTLSFVRDGTNRVPAEE 277 ++ S S S S ++DG SNT + S + TN +EE Sbjct: 300 DSTSSSSDSDSSSSSEDGNSNTDTTTSGEVSAQSSTNSTSSEE 342 >SPBC1706.01 |tea4|wsh3|tip elongation aberrant protein Tea4|Schizosaccharomyces pombe|chr 2|||Manual Length = 809 Score = 25.0 bits (52), Expect = 6.5 Identities = 10/50 (20%), Positives = 23/50 (46%) Frame = +3 Query: 75 NITFQHYLPTSNPSAQFPPRTFACATTKNHYRLDLRTLGLKMVVRTPKGL 224 N +F Y TSN P +++ + +++ D+ ++ + PK + Sbjct: 406 NASFSSYSSTSNTDKSLRPSSYSAVSESSNFTHDVSRDNKEISLNAPKSI 455 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,801,819 Number of Sequences: 5004 Number of extensions: 31867 Number of successful extensions: 108 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -