BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0602 (508 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024818-4|AAF60782.5| 457|Caenorhabditis elegans Hypothetical ... 27 5.9 Z78545-3|CAB01767.1| 306|Caenorhabditis elegans Hypothetical pr... 27 7.8 >AC024818-4|AAF60782.5| 457|Caenorhabditis elegans Hypothetical protein Y54H5A.4 protein. Length = 457 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +3 Query: 45 EWPKLKKNLINITFQHYLPTSNPSAQ 122 EW KL KN N+ F Y P AQ Sbjct: 428 EWEKLDKNYRNLLFTDYRPVETNVAQ 453 >Z78545-3|CAB01767.1| 306|Caenorhabditis elegans Hypothetical protein M03B6.4 protein. Length = 306 Score = 27.1 bits (57), Expect = 7.8 Identities = 18/71 (25%), Positives = 33/71 (46%) Frame = +3 Query: 105 SNPSAQFPPRTFACATTKNHYRLDLRTLGLKMVVRTPKGLFPHFRLSGMVRIVYRQRNWF 284 S PS+ + AC+T K+H +D + +P + + R R+ +R F Sbjct: 90 SAPSSIARNKVLACSTPKDHLEID-----RDLFKTSPIEVHGNLRTYSPKRLCQDKRIIF 144 Query: 285 RRQELRHVCSH 317 R Q++R++ H Sbjct: 145 RNQKIRNMAIH 155 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,097,945 Number of Sequences: 27780 Number of extensions: 185025 Number of successful extensions: 517 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 977860456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -