BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0594 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 25 2.1 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 24 3.7 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 24 4.8 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 25.0 bits (52), Expect = 2.1 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +1 Query: 418 CCNIWHWGXFDSH 456 CC +W W +SH Sbjct: 88 CCRLWRWPDLNSH 100 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 497 GRKHAAAAQAYYGNLVGRQHC 559 GR++A A AYYG ++ +C Sbjct: 523 GREYADIANAYYGPVIENFNC 543 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 23.8 bits (49), Expect = 4.8 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = -3 Query: 556 MLPAX*ISVVCLCSSGVLPAAIPAELKPSTGATYGSQT 443 MLP+ + + SGVL +L PS GA + T Sbjct: 493 MLPSVQSAETVILPSGVLETPFDVQLIPSVGAPVSNGT 530 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 461,630 Number of Sequences: 2352 Number of extensions: 6584 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -