BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0594 (654 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U35631-2|AAB61476.1| 1186|Drosophila melanogaster MEI-218 protein. 28 9.6 BT023750-1|AAZ41758.1| 1186|Drosophila melanogaster SD24912p pro... 28 9.6 AY122070-1|AAM52582.1| 1186|Drosophila melanogaster AT14088p pro... 28 9.6 AE014298-2524|AAF48699.1| 1186|Drosophila melanogaster CG8923-PC... 28 9.6 AE014298-2523|AAN09433.2| 1186|Drosophila melanogaster CG8923-PB... 28 9.6 >U35631-2|AAB61476.1| 1186|Drosophila melanogaster MEI-218 protein. Length = 1186 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 Query: 479 ETEHGSHLWESNXPQCHILQHRRPRLPLMQ 390 E +H HLWES Q L + RP L + Q Sbjct: 718 ENQHQQHLWESCIHQDEDLMYSRPLLDMDQ 747 >BT023750-1|AAZ41758.1| 1186|Drosophila melanogaster SD24912p protein. Length = 1186 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 Query: 479 ETEHGSHLWESNXPQCHILQHRRPRLPLMQ 390 E +H HLWES Q L + RP L + Q Sbjct: 718 ENQHQQHLWESCIHQDEDLMYSRPLLDMDQ 747 >AY122070-1|AAM52582.1| 1186|Drosophila melanogaster AT14088p protein. Length = 1186 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 Query: 479 ETEHGSHLWESNXPQCHILQHRRPRLPLMQ 390 E +H HLWES Q L + RP L + Q Sbjct: 718 ENQHQQHLWESCIHQDEDLMYSRPLLDMDQ 747 >AE014298-2524|AAF48699.1| 1186|Drosophila melanogaster CG8923-PC, isoform C protein. Length = 1186 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 Query: 479 ETEHGSHLWESNXPQCHILQHRRPRLPLMQ 390 E +H HLWES Q L + RP L + Q Sbjct: 718 ENQHQQHLWESCIHQDEDLMYSRPLLDMDQ 747 >AE014298-2523|AAN09433.2| 1186|Drosophila melanogaster CG8923-PB, isoform B protein. Length = 1186 Score = 28.3 bits (60), Expect = 9.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -2 Query: 479 ETEHGSHLWESNXPQCHILQHRRPRLPLMQ 390 E +H HLWES Q L + RP L + Q Sbjct: 718 ENQHQQHLWESCIHQDEDLMYSRPLLDMDQ 747 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,139,793 Number of Sequences: 53049 Number of extensions: 297911 Number of successful extensions: 553 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2786177250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -