BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0588 (369 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 23 1.5 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 22.6 bits (46), Expect = 1.5 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -1 Query: 309 SILVRGAXXGNGDSVTSNAIAVLIWVWRXTDHLT 208 SI R + +GD +T N + + + VWR +T Sbjct: 169 SIEARDSAIFDGDFITENNLPLGLEVWRDKVFIT 202 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,529 Number of Sequences: 438 Number of extensions: 920 Number of successful extensions: 4 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8804355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -