BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0579 (668 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 24 1.5 AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 24 1.5 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.6 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 6.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 8.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 8.0 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 21 8.0 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 292 DCVVRGRREQIGIIPIFTNPRFFKRSAELGLVA 194 DC+ E +G +P+ +P F + S E+GL + Sbjct: 335 DCI----HELLGHMPLLADPSFAQFSQEIGLAS 363 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 8 GAIGPIGANSVSSGLSWEQHPVLSRASSVPAHRALAGLL 124 G+ GP N VS +SWE H ++ + + + GL+ Sbjct: 38 GSYGPEAGN-VSCSVSWEVHDPVTNSDTYIGFLFVLGLI 75 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 524 LSTCDVAXSTGHSFRFSPHEL 586 L+ C STG S FSP EL Sbjct: 21 LTQCLQESSTGQSVEFSPMEL 41 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 156 PPVNRLLRHQPQVATRPSSADRL 224 PP LLR+ +AT P +L Sbjct: 827 PPTPNLLRYFASIATNPKEQAQL 849 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 8.0 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = +2 Query: 422 QEVHWHRSHRA---DLWRRI*ATGR-DRHARRISIDASLSTCDVAXSTGHSFRFS 574 +E+ W R++R DL +++ G + + DA + TC GHS R S Sbjct: 548 EEIKWERANRELPDDLRQKVLPDGTLVITSVQKKGDAGVYTCSARNKQGHSARRS 602 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 8.0 Identities = 16/55 (29%), Positives = 26/55 (47%), Gaps = 4/55 (7%) Frame = +2 Query: 422 QEVHWHRSHRA---DLWRRI*ATGR-DRHARRISIDASLSTCDVAXSTGHSFRFS 574 +E+ W R++R DL +++ G + + DA + TC GHS R S Sbjct: 548 EEIKWERANRELPDDLRQKVLPDGTLVITSVQKKGDAGVYTCSARNKQGHSARRS 602 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 166 TGSSATSHKSLQDR 207 T +S T+HKSLQ R Sbjct: 47 TKNSLTTHKSLQHR 60 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,756 Number of Sequences: 438 Number of extensions: 3185 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -