BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0514 (618 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 23 1.6 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 23 1.6 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 1.6 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 23 2.1 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 4.7 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 8.3 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 8.3 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 8.3 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 8.3 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 8.3 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 8.3 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 8.3 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 8.3 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 8.3 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +3 Query: 51 KIMSDKRIESMLFDYGTTNRTDYRNGEIRPQSITV 155 KI + I S + DY N + R + PQ V Sbjct: 30 KISDNSGINSQMIDYSRPNWSYLRTPQFEPQQFEV 64 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 23.4 bits (48), Expect = 1.6 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +3 Query: 51 KIMSDKRIESMLFDYGTTNRTDYRNGEIRPQSITV 155 KI + I S + DY N + R + PQ V Sbjct: 50 KISDNSGINSQMIDYSRPNWSYLRTPQFEPQQFEV 84 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 496 APLPDYQLLPTL*LWRKLQPPYVSP 570 AP P + L PT+ + +LQP ++P Sbjct: 59 APAPGHGLQPTMGDYTQLQPQRLAP 83 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 23.0 bits (47), Expect = 2.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 469 SCNFIFQCQAPLPDYQLLPTL 531 SCN +QCQ P Q P + Sbjct: 169 SCNRYWQCQGGYPRLQRCPAM 189 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 21.8 bits (44), Expect = 4.7 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 254 VHRPKQILGTDPRIVQQPCEKPKDTEREIA 343 V+ P +I+G C K T +EIA Sbjct: 193 VYEPVRIMGVHRPGFDNDCNKNTSTSKEIA 222 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 496 APLPDYQLLPTL*LWRKLQP 555 AP P + L PT+ + +LQP Sbjct: 59 APAPGHGLQPTMGDYTQLQP 78 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 496 APLPDYQLLPTL*LWRKLQP 555 AP P + L PT+ + +LQP Sbjct: 59 APAPGHGLQPTMGDYTQLQP 78 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 496 APLPDYQLLPTL*LWRKLQP 555 AP P + L PT+ + +LQP Sbjct: 59 APAPGHGLQPTMGDYTQLQP 78 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.0 bits (42), Expect = 8.3 Identities = 5/13 (38%), Positives = 8/13 (61%) Frame = +2 Query: 530 CSFGENCNLHTYL 568 C +G NC + Y+ Sbjct: 224 CKYGNNCEIDMYM 236 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 496 APLPDYQLLPTL*LWRKLQP 555 AP P + L PT+ + +LQP Sbjct: 59 APAPGHGLQPTMGDYTQLQP 78 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 496 APLPDYQLLPTL*LWRKLQP 555 AP P + L PT+ + +LQP Sbjct: 59 APAPGHGLQPTMGDYTQLQP 78 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 496 APLPDYQLLPTL*LWRKLQP 555 AP P + L PT+ + +LQP Sbjct: 15 APAPGHGLQPTMGDYTQLQP 34 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 496 APLPDYQLLPTL*LWRKLQP 555 AP P + L PT+ + +LQP Sbjct: 59 APAPGHGLQPTMGDYTQLQP 78 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 496 APLPDYQLLPTL*LWRKLQP 555 AP P + L PT+ + +LQP Sbjct: 59 APAPGHGLQPTMGDYTQLQP 78 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,910 Number of Sequences: 336 Number of extensions: 2906 Number of successful extensions: 17 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -