BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0514 (618 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025467-5|AAB71038.2| 1115|Caenorhabditis elegans Hypothetical ... 29 3.5 AF025467-4|AAN65300.1| 1130|Caenorhabditis elegans Hypothetical ... 29 3.5 U40061-6|AAA81152.2| 426|Caenorhabditis elegans Hypothetical pr... 27 8.1 >AF025467-5|AAB71038.2| 1115|Caenorhabditis elegans Hypothetical protein R148.3a protein. Length = 1115 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = +2 Query: 296 VQQPCEKPKDTEREIAQRTRPRIVMTPAVSMDDIXNPRARDILCNDMYTSDTSK 457 +Q+P P E P + TP S+DD+ ARD L ++ D K Sbjct: 293 IQEPTTTPAPLEAPAPVENAPNLP-TPTFSVDDLMAQAARDALNSNSIVPDAPK 345 >AF025467-4|AAN65300.1| 1130|Caenorhabditis elegans Hypothetical protein R148.3b protein. Length = 1130 Score = 28.7 bits (61), Expect = 3.5 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = +2 Query: 296 VQQPCEKPKDTEREIAQRTRPRIVMTPAVSMDDIXNPRARDILCNDMYTSDTSK 457 +Q+P P E P + TP S+DD+ ARD L ++ D K Sbjct: 293 IQEPTTTPAPLEAPAPVENAPNLP-TPTFSVDDLMAQAARDALNSNSIVPDAPK 345 >U40061-6|AAA81152.2| 426|Caenorhabditis elegans Hypothetical protein ZK563.6 protein. Length = 426 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = -3 Query: 442 SVHVVT*YIPGSWIXNVVHTDCRGHHYAGSGPLSDFSFCVFRFFARLLNN 293 SVHV+ + + + NV + + + Y G G L+D F R ++L + Sbjct: 22 SVHVIFRHGARAPVLNVTSEEAKSYFYRGLGQLTDEGFEQARLMGKVLRD 71 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,086,696 Number of Sequences: 27780 Number of extensions: 288724 Number of successful extensions: 700 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 674 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 700 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -