BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0513 (637 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 27 0.66 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 24 4.6 X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 23 6.1 AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha su... 23 8.1 AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha su... 23 8.1 AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha su... 23 8.1 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 26.6 bits (56), Expect = 0.66 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +1 Query: 379 NARNEYVDTTIAKAIDFYTQK 441 NA EYV TT+ KAI YT K Sbjct: 127 NADGEYVVTTLTKAILHYTGK 147 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 23.8 bits (49), Expect = 4.6 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -2 Query: 486 VIN*FSRTIHKESLSLLSVKVDRFCDRSVDIFVSRVHVE 370 + N RT E L L+ + R C R++D++ VH + Sbjct: 315 IANSGGRTTMAERLLKLNEYICRTCPRTIDLWKHFVHAD 353 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 23.4 bits (48), Expect = 6.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 223 YFWPKLIDDVVQPLQSE 173 Y W K++DD Q QSE Sbjct: 271 YQWRKVVDDFKQQTQSE 287 >AY724808-1|AAW50317.1| 206|Anopheles gambiae G protein alpha subunit AgGq6 protein. Length = 206 Score = 23.0 bits (47), Expect = 8.1 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -2 Query: 393 FVSRVHVEKISSPERVCQRIFKCS 322 F+ +V++ + P+R+C F C+ Sbjct: 159 FILKVYLRENPDPDRMCYSHFTCA 182 >AY724806-1|AAW50315.1| 163|Anopheles gambiae G protein alpha subunit AgGq4 protein. Length = 163 Score = 23.0 bits (47), Expect = 8.1 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -2 Query: 393 FVSRVHVEKISSPERVCQRIFKCS 322 F+ +V++ + P+R+C F C+ Sbjct: 116 FILKVYLRENPDPDRMCYSHFTCA 139 >AY724803-1|AAW50312.1| 162|Anopheles gambiae G protein alpha subunit AgGq1 protein. Length = 162 Score = 23.0 bits (47), Expect = 8.1 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -2 Query: 393 FVSRVHVEKISSPERVCQRIFKCS 322 F+ +V++ + P+R+C F C+ Sbjct: 115 FILKVYLRENPDPDRMCYSHFTCA 138 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 630,266 Number of Sequences: 2352 Number of extensions: 12507 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -