BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0501 (558 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 26 0.96 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 6.8 AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A... 23 9.0 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 25.8 bits (54), Expect = 0.96 Identities = 16/48 (33%), Positives = 20/48 (41%) Frame = -2 Query: 215 FESGSSKMCLALWNVFA**HCEHLQWSLSQQSSKGIEGPFSKFTRTVL 72 F SG KM L L CEHL SL + S++T V+ Sbjct: 138 FTSGRIKMTLPLITQVCERFCEHLNESLQSSDEIEVHDLLSRYTIDVI 185 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 6.8 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 117 KGNRRAILEVHTYRXLNKDDV 55 +GNR A +E HT+ L K +V Sbjct: 907 QGNRIAYIEDHTFAELRKLEV 927 >AF042732-3|AAC18058.1| 496|Anopheles gambiae diphenol oxidase-A2 protein. Length = 496 Score = 22.6 bits (46), Expect = 9.0 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 200 NCPIRRYLHYN 232 NC +R YLHY+ Sbjct: 215 NCLLRNYLHYS 225 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 499,887 Number of Sequences: 2352 Number of extensions: 8907 Number of successful extensions: 22 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -