BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0501 (558 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 26 0.30 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 24 0.91 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 24 0.91 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 24 0.91 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 21 6.4 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 6.4 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 8.4 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 25.8 bits (54), Expect = 0.30 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = +1 Query: 163 HANTFQRAKHILELPDSKILTLQFXKNSLTMNGTISXLQNSKRTFCRNSIIXL 321 H N + + ++ DSK+ TL N +T +S + + F N+ I L Sbjct: 579 HGNFIESLGNYYKIRDSKVKTLDASHNRITELSPLSVPDSVELLFINNNYINL 631 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 24.2 bits (50), Expect = 0.91 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = +3 Query: 390 VHVDEFLDSDDSSKEVFQSLLDYGVAFITG-----VQPSAEATETCAK 518 ++VDE L SD F+ L+D G G V P A AT+ C K Sbjct: 32 INVDEILHSDRLLNNYFKCLMDEGRCTAEGNELKRVLPDALATD-CKK 78 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 24.2 bits (50), Expect = 0.91 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = +3 Query: 390 VHVDEFLDSDDSSKEVFQSLLDYGVAFITG-----VQPSAEATETCAK 518 ++VDE L SD F+ L+D G G V P A AT+ C K Sbjct: 32 INVDEILHSDRLLNNYFKCLMDEGRCTAEGNELKRVLPDALATD-CKK 78 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 24.2 bits (50), Expect = 0.91 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 5/48 (10%) Frame = +3 Query: 390 VHVDEFLDSDDSSKEVFQSLLDYGVAFITG-----VQPSAEATETCAK 518 ++VDE L SD F+ L+D G G V P A AT+ C K Sbjct: 32 INVDEILHSDRLLNNYFKCLMDEGRCTAEGNELKRVLPDALATD-CKK 78 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.4 bits (43), Expect = 6.4 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 172 TFQRAKHILELPDSKILTLQFXKNSLTMNGTISXLQ-NSKRTF 297 TF+ K+++ D +TLQ KN++ T S + +RTF Sbjct: 517 TFREQKNLMIELDKFPITLQPGKNTIEQKSTKSSVTIPFERTF 559 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = -2 Query: 266 IVPFIVRLFLXNCNVSIFESGSSKMCLAL 180 + F+VR CN + S +C+AL Sbjct: 64 VAVFLVRKLRRPCNYLLVSLAVSDLCVAL 92 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 450 EAIEILPLNCRQSQETHQ 397 EAI L L+C Q + TH+ Sbjct: 865 EAIYQLMLDCWQKERTHR 882 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,395 Number of Sequences: 438 Number of extensions: 2377 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16072521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -