BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0492 (578 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 26 1.0 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 1.3 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 1.8 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 9.5 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 9.5 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.8 bits (54), Expect = 1.0 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 247 YNYHPWFLTSRTDTARV*DTLLLTRSHRAT 158 Y +HPW + R T +L+TR H T Sbjct: 1087 YGHHPWQASLRVKTMHWCGAVLITRYHVLT 1116 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.4 bits (53), Expect = 1.3 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -2 Query: 247 YNYHPWFLTSRTDTARV*DTLLLTRSHRAT 158 Y +HPW + R T +L+TR H T Sbjct: 1087 YGHHPWQASLRLKTMHWCGAVLITRYHVLT 1116 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.0 bits (52), Expect = 1.8 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +2 Query: 152 LYSGSVAPGQEQCILDSCSI-SPTCQEPRVIIVGAEWQDF 268 L SG + L + + SP C R I V +EW+ F Sbjct: 232 LLSGVIKLNSSSFFLKAIRVESPPCLHYRAITVNSEWRSF 271 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 22.6 bits (46), Expect = 9.5 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -3 Query: 402 RYPFCTHLNNCISKPT*MYSSTRTLIR 322 R P CT L NC ++ ++ + L++ Sbjct: 91 REPLCTRLRNCCTRQRKDFNPRKHLLK 117 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 22.6 bits (46), Expect = 9.5 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -3 Query: 402 RYPFCTHLNNCISKPT*MYSSTRTLIR 322 R P CT L NC ++ ++ + L++ Sbjct: 91 REPLCTRLRNCCTRQRKDFNPRKHLLK 117 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 643,927 Number of Sequences: 2352 Number of extensions: 15042 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -