BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0490 (399 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; ... 52 5e-06 UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Gr... 34 1.2 UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12... 32 3.6 UniRef50_Q4TGD5 Cluster: Chromosome undetermined SCAF3766, whole... 32 4.8 UniRef50_O44565 Cluster: Laminin related. see also lmb-protein 1... 32 4.8 >UniRef50_Q5MGF5 Cluster: Putative uncharacterized protein; n=2; Bombycoidea|Rep: Putative uncharacterized protein - Lonomia obliqua (Moth) Length = 74 Score = 51.6 bits (118), Expect = 5e-06 Identities = 24/47 (51%), Positives = 29/47 (61%) Frame = +2 Query: 113 IYGTGGLLTPLVAPVLXXXXXXXXXXXXXXXXXXYYGNLVAGSIVSQ 253 IYGTGGLLTP+VAP+L YYGN+VAGS++SQ Sbjct: 17 IYGTGGLLTPIVAPMLGFGSAGIAAGSTAAAAQAYYGNVVAGSVISQ 63 >UniRef50_Q0BU79 Cluster: Hypothetical cytosolic protein; n=1; Granulibacter bethesdensis CGDNIH1|Rep: Hypothetical cytosolic protein - Granulobacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) Length = 90 Score = 33.9 bits (74), Expect = 1.2 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +1 Query: 49 QKLKEHGA--SSCISGKRGRRCCNIWHWGSVDSISGSRAR 162 Q L+EHG S ++G+R RC N WH G D + R R Sbjct: 42 QALREHGTFQGSMLAGRRILRC-NPWHQGGYDPVPAGRCR 80 >UniRef50_P28618 Cluster: Pyrrolidone-carboxylate peptidase; n=12; Bacilli|Rep: Pyrrolidone-carboxylate peptidase - Bacillus subtilis Length = 215 Score = 32.3 bits (70), Expect = 3.6 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +1 Query: 28 LRIARREQKLKEHGASSCISGKRGRRCCNIWHWGSVDSIS 147 L + R K+KEHG + +S G CN +G +D IS Sbjct: 117 LPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHIS 156 >UniRef50_Q4TGD5 Cluster: Chromosome undetermined SCAF3766, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome undetermined SCAF3766, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 328 Score = 31.9 bits (69), Expect = 4.8 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -2 Query: 158 AREPLMESTDPQCHILQHRRPRLPLMQLE 72 A +PL T+P+ +LQ+RRP+L L L+ Sbjct: 5 AEQPLSLRTEPKLRVLQYRRPKLELQLLK 33 >UniRef50_O44565 Cluster: Laminin related. see also lmb-protein 1; n=2; Caenorhabditis|Rep: Laminin related. see also lmb-protein 1 - Caenorhabditis elegans Length = 1067 Score = 31.9 bits (69), Expect = 4.8 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +1 Query: 76 SCISGKRGRRC--CNIWHWGSVDSISGSRARFQLSGN 180 +C SG +G RC C HWGS + G+ R +GN Sbjct: 973 NCKSGYQGERCGECAQNHWGSPREVGGTCERCDCNGN 1009 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 348,929,473 Number of Sequences: 1657284 Number of extensions: 5716450 Number of successful extensions: 10921 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10909 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 16926675320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -