BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0482 (629 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 23 1.6 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 1.6 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 6.4 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 531 ENNSRLIGIMLKNIPNL 581 E+N +L+ +LKN PNL Sbjct: 46 ESNHKLVTFILKNPPNL 62 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 580 YFGLQNHKMPCVYYIY 627 YF L +PC+YY Y Sbjct: 201 YFTLHLLFLPCIYYFY 216 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 6.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 607 ASYGFVSQNKFGIFFNIXPMRRELFSFVRKQ 515 ASY FV + F F + P+R+ K+ Sbjct: 216 ASYVFVVIDVFSKFLKLYPLRKATAKIAAKR 246 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,536 Number of Sequences: 336 Number of extensions: 2767 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16188355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -