BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0482 (629 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-1574|AAN09290.1| 863|Drosophila melanogaster CG32668-P... 29 6.9 AE014296-1114|AAN12095.1| 127|Drosophila melanogaster CG32398-P... 28 9.1 >AE014298-1574|AAN09290.1| 863|Drosophila melanogaster CG32668-PA protein. Length = 863 Score = 28.7 bits (61), Expect = 6.9 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = -2 Query: 562 NIXPMRRELFSFVRKQSRNSKLGHKYERENMRTECGTR*IFIAFQRENIPLNVLTSN 392 +I + +EL++ VRKQ RN K G EC + + +A R + L V SN Sbjct: 197 HINAILQELYTRVRKQERNYKRGFILGGLYGLVECTSPRVLLAVARVVLALRVTGSN 253 >AE014296-1114|AAN12095.1| 127|Drosophila melanogaster CG32398-PA protein. Length = 127 Score = 28.3 bits (60), Expect = 9.1 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 147 FFYCLDLWANSQPTWC*VVTRAHRH 73 FF CL +WA S TW + +HR+ Sbjct: 76 FFVCLYIWAASSSTWRQQQSESHRN 100 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,802,478 Number of Sequences: 53049 Number of extensions: 418819 Number of successful extensions: 821 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 821 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2621070450 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -