BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0479 (558 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 24 0.91 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 23 2.8 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 6.4 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 24.2 bits (50), Expect = 0.91 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 17 CVLYVDKELFLFAIIK*IMSPEPTKVQVEYINEE 118 C ++V L FA++ M P TK Y +E+ Sbjct: 283 CSVFVFLSLMEFAVVNNYMGPVATKAMKGYSDED 316 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.6 bits (46), Expect = 2.8 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = +1 Query: 34 QRIIFVCHHKVDNVA*AYKSAGGIHQRGKTYKGGQRQPVAPGLIGCYLQSSR 189 Q+I+ + + AY +HQRGK G PG + +++ R Sbjct: 291 QQIVKFSLNSILKTVVAYGGTSVMHQRGKLSAGCHILVATPGRLLDFVEKGR 342 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 471 QQQFYNNSSSSRSKGY*FCCS 533 + Q NNSSS + + F CS Sbjct: 359 ESQICNNSSSDKERNSSFKCS 379 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,977 Number of Sequences: 438 Number of extensions: 1419 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16072521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -