BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0476 (399 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 0.84 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 22 2.6 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.4 bits (48), Expect = 0.84 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +1 Query: 193 LESIYLFSLPIKEFEIIDFFLARP*MMXFLRSCLYRN 303 L ++Y + E II+F M F +C+Y N Sbjct: 153 LFTVYYIYYSVHEASIINFGYTLAKFMIFTSTCIYTN 189 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 21.8 bits (44), Expect = 2.6 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 277 FLRSCLYRNKHVPDSAHVSRHLLPXATTT 363 ++ L + K PD A + RH LP A T Sbjct: 46 YVNCLLEKGKCTPDGAELKRH-LPDALHT 73 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,218 Number of Sequences: 336 Number of extensions: 1050 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8541369 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -