BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0474 (626 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0457 + 18076911-18077272,18077356-18077475,18077554-180777... 28 7.0 02_01_0387 - 2804990-2805059,2805106-2806086,2806856-2806875 28 7.0 11_06_0410 - 23223701-23223714,23223863-23225159,23225314-232262... 27 9.2 >10_08_0457 + 18076911-18077272,18077356-18077475,18077554-18077782, 18077993-18078652,18079224-18079425,18079521-18079611, 18079780-18079837 Length = 573 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 420 QSTLIHNATYGPSPVKQSDRRPAXNTFEKPRLTA 521 Q TL+H+ +P Q+ RRP EK T+ Sbjct: 363 QGTLLHSPLMAETPAMQTPRRPLPTQIEKLETTS 396 >02_01_0387 - 2804990-2805059,2805106-2806086,2806856-2806875 Length = 356 Score = 27.9 bits (59), Expect = 7.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 127 SSCSTCKW*CTESRGRSMGRSKNRR 201 +SC CK C S GRS R++ RR Sbjct: 252 TSCIFCKSFCRSSGGRSRARARERR 276 >11_06_0410 - 23223701-23223714,23223863-23225159,23225314-23226225, 23226952-23227023,23227323-23227471,23227879-23227912 Length = 825 Score = 27.5 bits (58), Expect = 9.2 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 375 SLFCHL*INKSKLIIQ--STLIHNATYGPS 458 +LFCH I KSKL Q S N+T GPS Sbjct: 758 ALFCHCGIEKSKLWQQQKSANFRNSTPGPS 787 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,744,339 Number of Sequences: 37544 Number of extensions: 178986 Number of successful extensions: 394 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 394 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -