BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0472 (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 4.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 6.0 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 21 7.9 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 7.9 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.8 bits (44), Expect = 4.5 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = -2 Query: 576 HPLDSLPYPILF 541 HPL+S+P+P ++ Sbjct: 105 HPLESVPFPQVY 116 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 6.0 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = +2 Query: 356 YY*RRLWDRSQIRLLLKLCLXDRFKTXINKNIMADIASL*VLLQMNVV 499 Y RR W S + +L L + IN+NI ++L + V Sbjct: 614 YNQRRRWMPSTMANILDLLMDYEHTVKINENISMPYIGYQIILMIGTV 661 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.0 bits (42), Expect = 7.9 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 469 AVGTTADECCEKXRDFRRTXIRALKKD 549 A+ T +C EK R I+ LKK+ Sbjct: 67 ALQTNCAKCTEKQRTAAYRSIKRLKKE 93 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 7.9 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = +1 Query: 316 YKNMIANHXKKFV 354 +KN++ NH ++FV Sbjct: 396 FKNLLENHYEEFV 408 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,196 Number of Sequences: 336 Number of extensions: 2000 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -