BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0472 (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0724 + 20975942-20976867,20977397-20977476,20977976-209783... 29 2.1 10_08_1051 - 22562840-22562971,22563474-22563576,22563701-225637... 27 8.6 >07_03_0724 + 20975942-20976867,20977397-20977476,20977976-20978370, 20988410-20989444 Length = 811 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = -1 Query: 379 IPKTSLVVLQTFSXGWLSCSCTIIGGSFMWINCLFSPVSTTYLSLESGNWGI 224 +P+ V L G L C C + G+F + + +P + ++ L NW I Sbjct: 31 LPQCHDVDLLDCCNGLLLCRCYVSRGTFQFHYAVCNPATKEWVMLPDANWAI 82 >10_08_1051 - 22562840-22562971,22563474-22563576,22563701-22563768, 22563896-22564053,22564706-22564895,22565162-22566205 Length = 564 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 391 YLASIPKTSLVVLQTFSXGWLSCSCTII 308 YLA++P + L F+ G LS CT++ Sbjct: 248 YLAALPMFHVYGLSLFAVGLLSLGCTVV 275 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,232,895 Number of Sequences: 37544 Number of extensions: 195577 Number of successful extensions: 376 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -