BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0472 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g75920.1 68414.m08818 family II extracellular lipase 5 (EXL5)... 28 5.4 At5g19400.1 68418.m02312 expressed protein 27 7.2 >At1g75920.1 68414.m08818 family II extracellular lipase 5 (EXL5) EXL5 (PMID:11431566); similar to anter-specific proline-rich protein (APG) SP:P40602 [Arabidopsis thaliana (Mouse-ear cress)] Length = 353 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 358 VLQTFSXGWLSCSCTIIGGSFMWINCLFSPVSTTY-LSLESG 236 V+ G L S I GG F+W N L + +S Y L+SG Sbjct: 224 VMGVIPLGCLPMSRLIFGGFFVWCNFLANTISEDYNKKLKSG 265 >At5g19400.1 68418.m02312 expressed protein Length = 1093 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 140 NPPNQNYWVVLREDXSNVILSTHNF 214 NPP+ N +LRE +IL +H F Sbjct: 37 NPPDPNLLQLLREKYEAIILESHTF 61 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,175,805 Number of Sequences: 28952 Number of extensions: 168559 Number of successful extensions: 372 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 372 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -