BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0468 (648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24440.1 68416.m03067 fibronectin type III domain-containing ... 30 1.2 At4g00955.1 68417.m00129 expressed protein 29 2.7 At1g72140.1 68414.m08341 proton-dependent oligopeptide transport... 28 4.7 At4g37550.1 68417.m05314 formamidase, putative / formamide amido... 28 6.1 At5g46650.1 68418.m05748 zinc finger (C3HC4-type RING finger) fa... 27 8.1 At4g30200.3 68417.m04295 expressed protein contains weak similar... 27 8.1 At4g30200.2 68417.m04294 expressed protein contains weak similar... 27 8.1 At4g30200.1 68417.m04293 expressed protein contains weak similar... 27 8.1 At3g46120.1 68416.m04991 calcineurin-like phosphoesterase family... 27 8.1 At3g05690.1 68416.m00636 CCAAT-binding transcription factor (CBF... 27 8.1 At2g26390.1 68415.m03167 serpin, putative / serine protease inhi... 27 8.1 >At3g24440.1 68416.m03067 fibronectin type III domain-containing protein contains Pfam profile PF00041: Fibronectin type III domain Length = 602 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 125 FCKMTSCCTCEGHHSGAKSSLPLVC 199 FCK SCC C SL LVC Sbjct: 64 FCKRCSCCVCHNFDENKDPSLWLVC 88 >At4g00955.1 68417.m00129 expressed protein Length = 252 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/58 (36%), Positives = 29/58 (50%) Frame = +1 Query: 427 INQQILDGYLDPGESISAPSVFPYMKTRAEKQSEVMMMKK*YTYYSFLIMYTNVLWHS 600 INQ+ LD L ES S FP + K SE + MK+ T S ++YT++ S Sbjct: 129 INQRFLDKQLKSCESTGNISCFP--SDTSSKSSEFLSMKE-LTNSSCRLLYTSIALES 183 >At1g72140.1 68414.m08341 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 555 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = -2 Query: 542 FIIITSLCFSALVFIYGKTLGAD---IDSPGSK*PSNICWLILYFL 414 F+ I S+ +ALV + D +DSP + P ++CWLI ++ Sbjct: 406 FLSIISMVIAALVEMKRLKTARDHGLVDSPKATVPMSVCWLIPQYI 451 >At4g37550.1 68417.m05314 formamidase, putative / formamide amidohydrolase, putative similar to SP|Q50228 Formamidase (EC 3.5.1.49) (Formamide amidohydrolase) {Methylophilus methylotrophus}; contains Pfam profile PF03069: Acetamidase/Formamidase family Length = 452 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = +2 Query: 134 MTSCCTCEGHHSGAKSSLPLVC--LVPRDGASSEARTKPRPA*LGPQL 271 + SCC CEG SG S V +P + R K R +GP++ Sbjct: 380 LLSCCPCEGRLSGIVDSPNAVATLAIPTAIFDQDIRPKNRKVPVGPRV 427 >At5g46650.1 68418.m05748 zinc finger (C3HC4-type RING finger) family protein contains similarity to RING-H2 zinc finger protein ATL6 [Arabidopsis thaliana] GI:4928403; contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 289 Score = 27.5 bits (58), Expect = 8.1 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +3 Query: 462 RXINICAERFPIYENEGRKAKRSDDDEEIIYILQLPDYVYKCPLA*SNHQNATGS 626 R I ++F + G R+ +EE Y L+LPD+V K + ++ N T S Sbjct: 207 RKIETLPDKFSRSKTTGHSIVRNKPEEEDRYTLRLPDHV-KIKVTRRHNNNQTES 260 >At4g30200.3 68417.m04295 expressed protein contains weak similarities to Pfam profiles: PF00041 Fibronectin type III domain, PF00628 PHD-finger; supporting cDNA gi|11177136|dbj|AB050977.1| Length = 702 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 Query: 125 FCKMTSCCTCEGHHSGAKSSLPLVC 199 FC+ SCC C + SL L C Sbjct: 161 FCRRCSCCICRKYDDNKDPSLWLTC 185 >At4g30200.2 68417.m04294 expressed protein contains weak similarities to Pfam profiles: PF00041 Fibronectin type III domain, PF00628 PHD-finger; supporting cDNA gi|11177136|dbj|AB050977.1| Length = 714 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 Query: 125 FCKMTSCCTCEGHHSGAKSSLPLVC 199 FC+ SCC C + SL L C Sbjct: 161 FCRRCSCCICRKYDDNKDPSLWLTC 185 >At4g30200.1 68417.m04293 expressed protein contains weak similarities to Pfam profiles: PF00041 Fibronectin type III domain, PF00628 PHD-finger; supporting cDNA gi|11177136|dbj|AB050977.1| Length = 685 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 Query: 125 FCKMTSCCTCEGHHSGAKSSLPLVC 199 FC+ SCC C + SL L C Sbjct: 144 FCRRCSCCICRKYDDNKDPSLWLTC 168 >At3g46120.1 68416.m04991 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 388 Score = 27.5 bits (58), Expect = 8.1 Identities = 14/60 (23%), Positives = 27/60 (45%) Frame = -1 Query: 408 VEMLTVFLCHRKGYKGTSIRVQIQRPLWQLKVFPDVLLVEQLEIILSCGPSYAGRGFVLA 229 + +L++F+ + G T +RV L+ FP E + +AGRG +++ Sbjct: 13 IALLSIFVVSQAGVTSTHVRVSEPSEEMPLETFPPPACYNAPEQVHITQGDHAGRGMIIS 72 >At3g05690.1 68416.m00636 CCAAT-binding transcription factor (CBF-B/NF-YA) family protein contains Pfam profile: PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B Length = 295 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 181 ESAAGLPGSSRWSIFGSQDKAPACIAG 261 E P +S W+ FGSQ AP +AG Sbjct: 8 EGLFSAPQTSWWTAFGSQPLAPESLAG 34 >At2g26390.1 68415.m03167 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 389 Score = 27.5 bits (58), Expect = 8.1 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 265 TTQNDFQLLDEEYIRKNFKLPQRALYLDPYRR-PLITFPMTQEDCKHFNL 411 T NDF LLD ++ F + + YL Y ++ P ED +HF++ Sbjct: 188 TKDNDFHLLDGNTVKVPFMMSYKDQYLRGYDGFQVLRLPYV-EDKRHFSM 236 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,458,443 Number of Sequences: 28952 Number of extensions: 307574 Number of successful extensions: 791 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 776 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 791 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -