BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0460 (331 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 20 5.8 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 20 7.7 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 20.2 bits (40), Expect = 5.8 Identities = 7/30 (23%), Positives = 15/30 (50%) Frame = -2 Query: 150 VYLTRHTSRLLRRPYSPMIFNSWSRRAFSK 61 VY+ S + Y + +N W ++ +S+ Sbjct: 53 VYIGTDLSYFISNVYQILAYNFWKKKYWSE 82 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 19.8 bits (39), Expect = 7.7 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = -1 Query: 133 YFTLVAETVLSDDLQLLVKTCLFKRTTRCHVRL*KYRRYSVV 8 + LVA +L+ LQ K T CH+ + Y V+ Sbjct: 327 HLQLVAIRLLNTKLQFTAKDFFNLDWTFCHMMIAALTTYLVI 368 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,328 Number of Sequences: 336 Number of extensions: 1210 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6367260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -