BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0459 (379 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe... 29 0.24 >SPMIT.01 |cox1||cytochrome c oxidase 1|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 537 Score = 29.1 bits (62), Expect = 0.24 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 351 SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 SP L N + F +F GVNI F PQ F Sbjct: 403 SPKMFGLMYNETLASIQFWILFIGVNIVFGPQHF 436 Score = 29.1 bits (62), Expect = 0.24 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 253 FLGLAGIPRRYSDYPD 206 FLGL G+PRR DYP+ Sbjct: 436 FLGLNGMPRRIPDYPE 451 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,096,318 Number of Sequences: 5004 Number of extensions: 14492 Number of successful extensions: 24 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 122233080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -