BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0459 (379 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF657363-3|ABR94684.1| 513|Homo sapiens cytochrome c oxidase su... 44 1e-04 AY922290-3|AAX15435.1| 513|Homo sapiens cytochrome c oxidase su... 44 1e-04 V00662-3|CAA24028.1| 513|Homo sapiens protein ( H.sapiens mitoc... 44 2e-04 J01415-3|AAB58945.1| 513|Homo sapiens cytochrome oxidase subuni... 44 2e-04 EU089747-3|ABU40228.1| 513|Homo sapiens cytochrome oxidase subu... 44 2e-04 EU089746-3|ABU40215.1| 513|Homo sapiens cytochrome oxidase subu... 44 2e-04 EU086510-3|ABU40202.1| 513|Homo sapiens cytochrome oxidase subu... 44 2e-04 EU080974-3|ABS87630.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU074158-3|ABS84019.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU073971-3|ABS84058.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU073970-3|ABS84045.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU073969-3|ABS84032.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU057183-3|ABS84006.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU052292-3|ABS57632.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU052289-3|ABS57619.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU051827-3|ABS58476.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU049814-3|ABS57606.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007895-3|ABS58463.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007894-3|ABS58450.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007893-3|ABS58437.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007892-3|ABS58424.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007891-3|ABS58411.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007890-3|ABS58398.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007889-3|ABS58385.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007888-3|ABS58372.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007887-3|ABS58359.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007886-3|ABS58346.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007885-3|ABS58333.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007884-3|ABS58320.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007883-3|ABS58307.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007882-3|ABS58294.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007881-3|ABS58281.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007880-3|ABS58268.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007879-3|ABS58255.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007878-3|ABS58242.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007877-3|ABS58229.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007876-3|ABS58216.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007875-3|ABS58203.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007874-3|ABS58190.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007873-3|ABS58177.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007872-3|ABS58164.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007871-3|ABS58151.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007870-3|ABS58138.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007869-3|ABS58125.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007868-3|ABS58112.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007867-3|ABS58099.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007866-3|ABS58086.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007865-3|ABS58073.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007864-3|ABS58060.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007863-3|ABS58047.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007862-3|ABS58034.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007861-3|ABS58021.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007860-3|ABS58008.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007859-3|ABS57995.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007858-3|ABS57982.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007857-3|ABS57969.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007856-3|ABS57956.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007855-3|ABS57943.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007854-3|ABS57930.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007853-3|ABS57917.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007852-3|ABS57904.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007851-3|ABS57891.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007850-3|ABS57878.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007849-3|ABS57865.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007848-3|ABS57852.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007847-3|ABS57839.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007846-3|ABS57826.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007845-3|ABS57813.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007844-3|ABS57800.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007843-3|ABS57787.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007842-3|ABS57774.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007841-3|ABS57761.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007840-3|ABS57748.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007839-3|ABS57735.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007838-3|ABS57722.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007837-3|ABS57709.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007836-3|ABS57696.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EU007835-3|ABS57683.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF692533-3|ABR57512.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661013-2|ABR58824.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661012-3|ABR58812.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661011-3|ABR58799.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661010-3|ABR58786.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661009-3|ABR58773.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661008-3|ABR58760.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661007-3|ABR58747.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661006-3|ABR58734.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661005-3|ABR58722.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661004-3|ABR58709.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661003-3|ABR58696.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661002-3|ABR58684.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661001-3|ABR58672.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF661000-2|ABR58659.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660999-3|ABR58647.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660998-3|ABR58634.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660997-3|ABR58621.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660996-3|ABR58609.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660995-3|ABR58597.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660994-3|ABR58585.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660993-2|ABR58572.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660992-3|ABR58560.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660991-3|ABR58547.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660990-3|ABR58534.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660989-3|ABR58521.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660988-2|ABR58508.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660987-3|ABR58496.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660986-3|ABR58483.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660985-3|ABR58470.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660984-3|ABR58457.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660983-3|ABR58444.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660982-3|ABR58431.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660981-3|ABR58418.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660980-3|ABR58405.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660979-3|ABR58392.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660978-3|ABR58379.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660977-3|ABR58366.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660976-3|ABR58353.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660975-3|ABR58340.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660974-3|ABR58327.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660973-3|ABR58314.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660972-2|ABR58303.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660971-3|ABR58291.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660970-3|ABR58278.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660969-3|ABR58265.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660968-3|ABR58252.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660967-3|ABR58239.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660966-3|ABR58226.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660964-3|ABR58200.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660963-3|ABR58187.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660962-3|ABR58174.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660961-3|ABR58161.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660960-3|ABR58148.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660959-3|ABR58135.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660958-3|ABR58122.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660957-3|ABR58109.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660956-3|ABR58096.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660955-3|ABR58083.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660954-3|ABR58070.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660953-3|ABR58057.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660952-3|ABR58044.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660951-3|ABR58031.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660950-3|ABR58018.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660949-3|ABR58005.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660948-3|ABR57992.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660947-3|ABR57979.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660946-3|ABR57966.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660945-3|ABR57953.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660944-3|ABR57940.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660943-3|ABR57927.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660942-3|ABR57914.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660941-3|ABR57901.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660940-3|ABR57888.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660939-3|ABR57875.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660938-3|ABR57862.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660937-3|ABR57849.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660936-3|ABR57836.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660935-3|ABR57823.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660934-3|ABR57810.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660933-3|ABR57797.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660932-3|ABR57784.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660931-3|ABR57771.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660930-3|ABR57759.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660929-3|ABR57746.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660928-3|ABR57733.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660927-3|ABR57720.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660926-3|ABR57707.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660925-3|ABR57694.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660924-3|ABR57681.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660923-3|ABR57668.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660922-3|ABR57655.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660921-3|ABR57642.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660920-3|ABR57629.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660919-3|ABR57616.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660918-3|ABR57603.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660917-3|ABR57590.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660916-3|ABR57577.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660915-3|ABR57564.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660914-3|ABR57551.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660913-3|ABR57538.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF660912-3|ABR57525.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657790-3|ABS00229.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657789-3|ABS00216.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657788-3|ABS00203.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657787-3|ABS00190.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657786-3|ABS00177.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657785-3|ABS00164.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657784-3|ABS00151.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657783-3|ABS00138.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657782-3|ABS00125.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657781-3|ABS00112.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657780-3|ABS00099.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657779-3|ABS00086.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657778-3|ABS00073.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657777-3|ABS00060.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657776-3|ABS00047.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657775-3|ABS00034.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657774-3|ABS00021.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657773-3|ABS00008.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657772-3|ABR99994.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657771-3|ABR99981.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657770-3|ABR99968.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657769-3|ABR99955.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657768-3|ABR99942.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657767-3|ABR99929.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657766-3|ABR99916.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657765-3|ABR99903.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657764-3|ABR99890.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657763-3|ABR99877.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657762-3|ABR99864.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657761-3|ABR99851.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657760-3|ABR99838.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657759-3|ABR99825.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657758-3|ABR99812.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657757-3|ABR99799.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657756-3|ABR99786.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657755-3|ABR99773.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657754-3|ABR99760.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657753-3|ABR99747.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657752-3|ABR99734.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657751-3|ABR99721.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657750-3|ABR99708.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657749-3|ABR99695.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657748-3|ABR99682.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657746-3|ABR99657.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657745-3|ABR99644.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657744-3|ABR99631.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657743-3|ABR99618.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657742-3|ABR99605.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657741-3|ABR99592.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657740-3|ABR99579.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657739-3|ABR99566.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657738-3|ABR99553.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657737-3|ABR99540.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657736-3|ABR99527.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657735-3|ABR99514.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657734-3|ABR99501.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657733-3|ABR99488.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657732-3|ABR99475.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657731-3|ABR99462.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657730-3|ABR99449.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657729-3|ABR99436.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657728-3|ABR99423.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657727-3|ABR99410.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657726-3|ABR99397.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657725-3|ABR99384.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657724-3|ABR99371.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657723-3|ABR99358.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657722-3|ABR99345.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657721-3|ABR99332.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657720-3|ABR99319.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657719-3|ABR99306.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657718-3|ABR99293.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657717-3|ABR99280.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657716-3|ABR99267.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657715-3|ABR99254.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657714-3|ABR99241.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657713-3|ABR99228.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657712-3|ABR99215.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657711-3|ABR99202.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657710-3|ABR99189.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657709-3|ABR99176.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657708-3|ABR99163.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657707-3|ABR99150.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657706-3|ABR99137.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657705-3|ABR99124.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657704-3|ABR99111.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657703-3|ABR99098.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657702-3|ABR99085.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657701-3|ABR99072.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657700-3|ABR99059.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657699-3|ABR99046.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657698-3|ABR99033.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657697-3|ABR99020.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657696-3|ABR99007.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657695-3|ABR98994.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657694-3|ABR98981.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657693-3|ABR98968.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657692-2|ABR98955.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657691-3|ABR98943.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657690-3|ABR98930.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657689-3|ABR98917.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657688-3|ABR98904.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657687-3|ABR98891.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657686-3|ABR98878.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657685-3|ABR98865.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657684-3|ABR98852.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657683-3|ABR98839.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657682-3|ABR98826.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657681-3|ABR98813.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657680-3|ABR98800.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657679-3|ABR98787.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657678-3|ABR98774.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657677-3|ABR98761.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657676-3|ABR98748.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657675-3|ABR98735.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657674-3|ABR98722.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657673-3|ABR98709.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657672-3|ABR98696.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657671-3|ABR98683.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657670-3|ABR98670.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657669-3|ABR98657.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657668-3|ABR98644.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657667-3|ABR98631.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657666-3|ABR98618.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657665-3|ABR98605.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657664-3|ABR98592.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657663-3|ABR98579.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657662-3|ABR98566.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657661-3|ABR98553.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657660-3|ABR98540.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657659-3|ABR98527.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657658-3|ABR98514.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657657-3|ABR98501.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657656-3|ABR98488.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657655-3|ABR98475.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657654-3|ABR98462.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657653-3|ABR98449.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657652-3|ABR98436.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657651-3|ABR98423.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657650-3|ABR98410.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657649-3|ABR98397.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657648-3|ABR98384.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657647-3|ABR98371.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657646-3|ABR98358.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657645-3|ABR98345.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657644-3|ABR98332.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657643-3|ABR98319.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657642-3|ABR98306.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657641-3|ABR98293.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657640-3|ABR98280.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657639-3|ABR98267.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657638-3|ABR98254.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657637-3|ABR98241.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657636-3|ABR98228.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657635-3|ABR98215.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657634-3|ABR98202.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657633-3|ABR98189.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657632-3|ABR98176.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657631-3|ABR98163.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657630-3|ABR98150.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657629-3|ABR98137.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657628-3|ABR98124.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657627-3|ABR98111.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657626-3|ABR98098.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657625-3|ABR98085.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657624-3|ABR98072.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657623-3|ABR98059.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657622-3|ABR98046.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657621-3|ABR98033.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657620-3|ABR98020.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657619-3|ABR98007.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657618-3|ABR97994.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657617-3|ABR97981.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657616-3|ABR97968.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657615-3|ABR97955.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657614-3|ABR97942.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657613-3|ABR97929.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657612-3|ABR97916.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657611-3|ABR97903.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657610-3|ABR97890.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657609-3|ABR97877.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657608-3|ABR97864.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657607-3|ABR97851.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657606-3|ABR97838.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657605-3|ABR97825.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657604-3|ABR97812.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657603-3|ABR97799.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657602-3|ABR97786.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657601-3|ABR97773.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657600-3|ABR97760.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657599-3|ABR97747.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657598-3|ABR97734.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657597-3|ABR97721.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657596-3|ABR97708.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657595-3|ABR97695.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657593-3|ABR97670.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657592-3|ABR97657.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657591-3|ABR97644.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657590-3|ABR97631.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657589-3|ABR97618.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657588-3|ABR97605.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657587-3|ABR97592.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657586-3|ABR97579.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657585-3|ABR97566.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657584-3|ABR97553.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657583-3|ABR97540.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657582-3|ABR97527.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657581-3|ABR97514.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657580-3|ABR97501.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657579-3|ABR97488.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657578-3|ABR97475.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657577-3|ABR97462.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657576-3|ABR97449.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657575-3|ABR97436.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657574-3|ABR97423.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657573-3|ABR97410.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657572-3|ABR97397.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657571-3|ABR97384.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657569-3|ABR97358.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657568-3|ABR97345.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657567-3|ABR97332.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657566-3|ABR97319.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657565-3|ABR97306.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657564-3|ABR97293.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657563-3|ABR97280.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657562-3|ABR97267.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657561-3|ABR97254.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657560-3|ABR97241.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657559-3|ABR97228.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657558-3|ABR97215.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657557-3|ABR97202.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657556-3|ABR97189.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657555-3|ABR97176.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657554-3|ABR97163.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657553-3|ABR97150.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657552-3|ABR97137.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657551-3|ABR97124.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657550-3|ABR97111.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657549-2|ABR97098.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657548-3|ABR97086.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657547-3|ABR97073.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657546-3|ABR97060.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657545-3|ABR97047.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657544-3|ABR97034.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657543-3|ABR97021.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657542-3|ABR97008.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657541-2|ABR96995.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657540-3|ABR96983.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657539-3|ABR96970.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657538-3|ABR96957.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657537-3|ABR96944.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657536-3|ABR96931.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657535-3|ABR96918.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657534-3|ABR96905.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657533-3|ABR96892.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657532-3|ABR96879.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657531-3|ABR96866.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657530-3|ABR96853.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657529-3|ABR96840.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657528-3|ABR96827.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657527-3|ABR96814.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657526-3|ABR96801.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657525-3|ABR96788.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657524-3|ABR96775.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657523-3|ABR96762.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657522-3|ABR96749.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657521-3|ABR96736.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657520-3|ABR96723.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657519-3|ABR96710.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657518-3|ABR96697.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657517-3|ABR96684.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657516-3|ABR96671.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657515-3|ABR96658.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657514-3|ABR96645.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657513-3|ABR96632.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657512-3|ABR96619.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657511-3|ABR96606.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657510-3|ABR96593.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657509-3|ABR96580.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657508-3|ABR96567.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657507-3|ABR96554.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657506-3|ABR96541.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657505-3|ABR96528.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657504-3|ABR96515.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657503-3|ABR96502.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657502-3|ABR96489.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657501-3|ABR96476.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657500-3|ABR96463.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657499-3|ABR96450.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657498-3|ABR96437.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657497-3|ABR96425.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657496-3|ABR96412.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657495-3|ABR96399.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657494-3|ABR96386.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657493-3|ABR96373.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657492-3|ABR96360.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657491-3|ABR96347.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657490-3|ABR96334.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657489-3|ABR96321.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657488-3|ABR96308.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657487-3|ABR96295.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657486-3|ABR96282.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657485-3|ABR96269.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657484-3|ABR96256.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657483-3|ABR96243.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657482-3|ABR96230.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657481-3|ABR96217.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657480-3|ABR96204.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657479-3|ABR96191.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657478-3|ABR96178.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657477-3|ABR96165.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657476-3|ABR96152.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657475-3|ABR96139.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657474-3|ABR96126.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657473-3|ABR96113.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657472-3|ABR96100.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657471-3|ABR96087.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657470-3|ABR96074.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657469-3|ABR96061.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 EF657468-3|ABR96048.1| 513|Homo sapiens cytochrome c oxidase su... 44 2e-04 >EF657363-3|ABR94684.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTVMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >AY922290-3|AAX15435.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.4 bits (100), Expect = 1e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTVMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >V00662-3|CAA24028.1| 513|Homo sapiens protein ( H.sapiens mitochondrial genome. ). Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >J01415-3|AAB58945.1| 513|Homo sapiens cytochrome oxidase subunit 1 protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU089747-3|ABU40228.1| 513|Homo sapiens cytochrome oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU089746-3|ABU40215.1| 513|Homo sapiens cytochrome oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU086510-3|ABU40202.1| 513|Homo sapiens cytochrome oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU080974-3|ABS87630.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU074158-3|ABS84019.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU073971-3|ABS84058.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU073970-3|ABS84045.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU073969-3|ABS84032.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU057183-3|ABS84006.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU052292-3|ABS57632.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU052289-3|ABS57619.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU051827-3|ABS58476.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU049814-3|ABS57606.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007895-3|ABS58463.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007894-3|ABS58450.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007893-3|ABS58437.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007892-3|ABS58424.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007891-3|ABS58411.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007890-3|ABS58398.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007889-3|ABS58385.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007888-3|ABS58372.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007887-3|ABS58359.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007886-3|ABS58346.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007885-3|ABS58333.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007884-3|ABS58320.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007883-3|ABS58307.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007882-3|ABS58294.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007881-3|ABS58281.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007880-3|ABS58268.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007879-3|ABS58255.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007878-3|ABS58242.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007877-3|ABS58229.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007876-3|ABS58216.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007875-3|ABS58203.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007874-3|ABS58190.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007873-3|ABS58177.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007872-3|ABS58164.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007871-3|ABS58151.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007870-3|ABS58138.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007869-3|ABS58125.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007868-3|ABS58112.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007867-3|ABS58099.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007866-3|ABS58086.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007865-3|ABS58073.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007864-3|ABS58060.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007863-3|ABS58047.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007862-3|ABS58034.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007861-3|ABS58021.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007860-3|ABS58008.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007859-3|ABS57995.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007858-3|ABS57982.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007857-3|ABS57969.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007856-3|ABS57956.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007855-3|ABS57943.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007854-3|ABS57930.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007853-3|ABS57917.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007852-3|ABS57904.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007851-3|ABS57891.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007850-3|ABS57878.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007849-3|ABS57865.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007848-3|ABS57852.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007847-3|ABS57839.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007846-3|ABS57826.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007845-3|ABS57813.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007844-3|ABS57800.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007843-3|ABS57787.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007842-3|ABS57774.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007841-3|ABS57761.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007840-3|ABS57748.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007839-3|ABS57735.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007838-3|ABS57722.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007837-3|ABS57709.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007836-3|ABS57696.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EU007835-3|ABS57683.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF692533-3|ABR57512.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661013-2|ABR58824.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661012-3|ABR58812.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661011-3|ABR58799.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661010-3|ABR58786.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661009-3|ABR58773.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661008-3|ABR58760.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661007-3|ABR58747.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661006-3|ABR58734.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661005-3|ABR58722.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661004-3|ABR58709.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661003-3|ABR58696.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661002-3|ABR58684.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661001-3|ABR58672.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF661000-2|ABR58659.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660999-3|ABR58647.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660998-3|ABR58634.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660997-3|ABR58621.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660996-3|ABR58609.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660995-3|ABR58597.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660994-3|ABR58585.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660993-2|ABR58572.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660992-3|ABR58560.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660991-3|ABR58547.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660990-3|ABR58534.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660989-3|ABR58521.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660988-2|ABR58508.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660987-3|ABR58496.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660986-3|ABR58483.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660985-3|ABR58470.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660984-3|ABR58457.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660983-3|ABR58444.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660982-3|ABR58431.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660981-3|ABR58418.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660980-3|ABR58405.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660979-3|ABR58392.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660978-3|ABR58379.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660977-3|ABR58366.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660976-3|ABR58353.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660975-3|ABR58340.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660974-3|ABR58327.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660973-3|ABR58314.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660972-2|ABR58303.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660971-3|ABR58291.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660970-3|ABR58278.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660969-3|ABR58265.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660968-3|ABR58252.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660967-3|ABR58239.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660966-3|ABR58226.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660964-3|ABR58200.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660963-3|ABR58187.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660962-3|ABR58174.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660961-3|ABR58161.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660960-3|ABR58148.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660959-3|ABR58135.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660958-3|ABR58122.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660957-3|ABR58109.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660956-3|ABR58096.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660955-3|ABR58083.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660954-3|ABR58070.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660953-3|ABR58057.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660952-3|ABR58044.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660951-3|ABR58031.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660950-3|ABR58018.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660949-3|ABR58005.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660948-3|ABR57992.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660947-3|ABR57979.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660946-3|ABR57966.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660945-3|ABR57953.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660944-3|ABR57940.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660943-3|ABR57927.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660942-3|ABR57914.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660941-3|ABR57901.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660940-3|ABR57888.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660939-3|ABR57875.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660938-3|ABR57862.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660937-3|ABR57849.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660936-3|ABR57836.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660935-3|ABR57823.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660934-3|ABR57810.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660933-3|ABR57797.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660932-3|ABR57784.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660931-3|ABR57771.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660930-3|ABR57759.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660929-3|ABR57746.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660928-3|ABR57733.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660927-3|ABR57720.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660926-3|ABR57707.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660925-3|ABR57694.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660924-3|ABR57681.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660923-3|ABR57668.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660922-3|ABR57655.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660921-3|ABR57642.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660920-3|ABR57629.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660919-3|ABR57616.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660918-3|ABR57603.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660917-3|ABR57590.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660916-3|ABR57577.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660915-3|ABR57564.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660914-3|ABR57551.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660913-3|ABR57538.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF660912-3|ABR57525.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657790-3|ABS00229.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657789-3|ABS00216.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657788-3|ABS00203.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657787-3|ABS00190.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657786-3|ABS00177.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657785-3|ABS00164.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657784-3|ABS00151.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657783-3|ABS00138.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657782-3|ABS00125.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657781-3|ABS00112.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657780-3|ABS00099.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657779-3|ABS00086.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657778-3|ABS00073.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657777-3|ABS00060.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657776-3|ABS00047.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657775-3|ABS00034.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657774-3|ABS00021.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657773-3|ABS00008.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657772-3|ABR99994.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657771-3|ABR99981.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657770-3|ABR99968.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657769-3|ABR99955.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657768-3|ABR99942.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657767-3|ABR99929.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657766-3|ABR99916.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657765-3|ABR99903.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657764-3|ABR99890.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657763-3|ABR99877.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657762-3|ABR99864.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657761-3|ABR99851.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657760-3|ABR99838.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657759-3|ABR99825.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657758-3|ABR99812.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657757-3|ABR99799.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657756-3|ABR99786.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657755-3|ABR99773.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657754-3|ABR99760.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657753-3|ABR99747.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657752-3|ABR99734.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657751-3|ABR99721.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657750-3|ABR99708.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657749-3|ABR99695.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657748-3|ABR99682.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657746-3|ABR99657.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657745-3|ABR99644.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657744-3|ABR99631.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657743-3|ABR99618.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFAIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657742-3|ABR99605.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657741-3|ABR99592.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657740-3|ABR99579.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657739-3|ABR99566.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657738-3|ABR99553.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657737-3|ABR99540.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657736-3|ABR99527.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657735-3|ABR99514.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657734-3|ABR99501.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657733-3|ABR99488.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657732-3|ABR99475.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657731-3|ABR99462.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657730-3|ABR99449.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657729-3|ABR99436.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657728-3|ABR99423.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657727-3|ABR99410.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657726-3|ABR99397.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657725-3|ABR99384.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657724-3|ABR99371.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657723-3|ABR99358.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657722-3|ABR99345.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657721-3|ABR99332.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 >EF657720-3|ABR99319.1| 513|Homo sapiens cytochrome c oxidase subunit I protein. Length = 513 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = -2 Query: 378 AIMGGFIN*SPLFTXLSXNSYILKXXFXTIFXGVNITFXPQLF 250 AIMGGFI+ PLF+ + + K F +F GVN+TF PQ F Sbjct: 388 AIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIGVNLTFFPQHF 430 Score = 37.9 bits (84), Expect = 0.011 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = -1 Query: 265 FXTTFLGLAGIPRRYSDYPD 206 F FLGL+G+PRRYSDYPD Sbjct: 426 FPQHFLGLSGMPRRYSDYPD 445 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,600,489 Number of Sequences: 237096 Number of extensions: 432761 Number of successful extensions: 7928 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7928 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2536788584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -