BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesS0458 (659 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0021 + 11307795-11308093,11308454-11308556,11309623-113099... 33 0.15 10_08_0419 - 17783202-17784938 31 1.1 03_05_0586 - 25875703-25876332,25876426-25876713,25877064-258771... 30 1.9 >08_02_0021 + 11307795-11308093,11308454-11308556,11309623-11309931, 11310190-11310618 Length = 379 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = +1 Query: 205 SEEDWHKTRNSF*SIGTRSPGRGELYNGYSGREHRTSHPLEAAADRR 345 S ++W R SF R GRG ++ Y GR+ R P A RR Sbjct: 120 SMQEWSSERCSFVQEALRGSGRGHIWAFYRGRQRRLGPPPPLPARRR 166 >10_08_0419 - 17783202-17784938 Length = 578 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/64 (29%), Positives = 29/64 (45%) Frame = +2 Query: 266 DAANSIMGIVVENIEPHIHWKPQLIDGILKYGDRVHTMSLPRASAPPGLRPNEIIDQFHV 445 DA + I G+ N+EP + LID + G M++ A A G+ PN + Sbjct: 352 DANDWIDGMTERNVEPDVVIYNILIDVYRRLGKMEDAMAVKEAMAKKGISPNVTTYNCLI 411 Query: 446 TNFN 457 T F+ Sbjct: 412 TGFS 415 >03_05_0586 - 25875703-25876332,25876426-25876713,25877064-25877194, 25877299-25877812 Length = 520 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 12/57 (21%) Frame = +2 Query: 173 HGPHQPRPSFGQRKTG------------TRRGILFRASERDHQDAANSIMGIVVENI 307 HGPH P P FG+ G R G L+ A R D A + + V NI Sbjct: 253 HGPHWPLPPFGESSRGPFNILEQRPRFANRHGRLYEADARSFHDLAEHDIRVAVVNI 309 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,746,563 Number of Sequences: 37544 Number of extensions: 294360 Number of successful extensions: 974 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 950 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 974 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -